HIST2H2BE Protein, Human
The HIST2H2BE protein is a core component of nucleosomes, key structures in chromatin organization that wrap and compact DNA, controlling its accessibility to cellular machinery based on DNA templates. This integral role of histones, including HIST2H2BE, extends to transcriptional regulation, DNA repair, DNA replication, and chromosomal stability. HIST2H2BE Protein, Human is the recombinant human-derived HIST2H2BE protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The HIST2H2BE protein is a core component of nucleosomes, key structures in chromatin organization that wrap and compact DNA, controlling its accessibility to cellular machinery based on DNA templates. This integral role of histones, including HIST2H2BE, extends to transcriptional regulation, DNA repair, DNA replication, and chromosomal stability. HIST2H2BE Protein, Human is the recombinant human-derived HIST2H2BE protein, expressed by E. coli , with tag free.
Histone HIST2H2BE is a core component of the nucleosome, serving a pivotal role in wrapping and compacting DNA into chromatin. This compaction restricts DNA accessibility to cellular machineries, impacting crucial processes such as transcription regulation, DNA repair, DNA replication, and chromosomal stability. The regulation of DNA accessibility involves a complex interplay of post-translational modifications known as the histone code, along with nucleosome remodeling. Beyond its chromatin-associated functions, HIST2H2BE exhibits broad antibacterial activity, suggesting potential contributions to the formation of the functional antimicrobial barrier in the colonic epithelium. Additionally, this histone may play a role in the bactericidal activity of amniotic fluid, highlighting its multifaceted significance in both chromatin dynamics and host defense mechanisms against microbial threats.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q16778 (M1-K126)
-
Gene ID8349 [NCBI]
-
Molecular Construction
-
N-term
-
HIST2H2BE (M1-K126)
Accession # Q16778 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
H2BC21; H2B Histone Family, Member Q; Prev. HIST2H2BE; Histone H2B Type 2-E; Prev. H2BFQ; Histone H2B-GL105; Prev. H2B; Histone 2, H2be; H2B-GL105; Histone H2B.Q; H2B/Q; H2B-Clustered Histone 21; H2B.1; H2BGL105; H2BE; GL105; Histone Cluster 2 H2B Family
-
AA Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
-
Data Sheet (234 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
