1. Recombinant Proteins
  2. Others
  3. HIST2H2BE Protein, Human

The HIST2H2BE protein is a core component of nucleosomes, key structures in chromatin organization that wrap and compact DNA, controlling its accessibility to cellular machinery based on DNA templates. This integral role of histones, including HIST2H2BE, extends to transcriptional regulation, DNA repair, DNA replication, and chromosomal stability. HIST2H2BE Protein, Human is the recombinant human-derived HIST2H2BE protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HIST2H2BE protein is a core component of nucleosomes, key structures in chromatin organization that wrap and compact DNA, controlling its accessibility to cellular machinery based on DNA templates. This integral role of histones, including HIST2H2BE, extends to transcriptional regulation, DNA repair, DNA replication, and chromosomal stability. HIST2H2BE Protein, Human is the recombinant human-derived HIST2H2BE protein, expressed by E. coli , with tag free.

Background

Histone HIST2H2BE is a core component of the nucleosome, serving a pivotal role in wrapping and compacting DNA into chromatin. This compaction restricts DNA accessibility to cellular machineries, impacting crucial processes such as transcription regulation, DNA repair, DNA replication, and chromosomal stability. The regulation of DNA accessibility involves a complex interplay of post-translational modifications known as the histone code, along with nucleosome remodeling. Beyond its chromatin-associated functions, HIST2H2BE exhibits broad antibacterial activity, suggesting potential contributions to the formation of the functional antimicrobial barrier in the colonic epithelium. Additionally, this histone may play a role in the bactericidal activity of amniotic fluid, highlighting its multifaceted significance in both chromatin dynamics and host defense mechanisms against microbial threats.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q16778 (M1-K126)

Gene ID

8349  [NCBI]

Molecular Construction
N-term
HIST2H2BE (M1-K126)
Accession # Q16778
C-term
Protein Length

Full Length

Synonyms
Histone H2B type 2-E; Histone H2B-GL105; H2B/q; H2BC21; H2BFQ
AA Sequence

MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Molecular Weight

Approximately 16 kDa.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HIST2H2BE Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HIST2H2BE Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HIST2H2BE Protein, Human
Cat. No.:
HY-P76381
Quantity:
MCE Japan Authorized Agent: