MBP Protein, Mouse (His)

MBP proteins, especially the classical isoforms 4-13, dominate myelin membranes in the central nervous system and are critical for myelination and stability.In contrast, the non-canonical isoform 1-3/Golli-MBP may be involved in early brain development and contribute to transcriptional complexes that influence multiple cellular processes.MBP Protein, Mouse (His) is the recombinant mouse-derived MBP protein, expressed by E.coli , with N-His labeled tag.

The classic group of MBP isoforms (isoform 4-isoform 13) stands as the predominant protein constituents alongside PLP in the myelin membrane of the central nervous system (CNS), playing vital roles in both the formation and stabilization of the myelin sheath. Conversely, the non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may be particularly involved in the early stages of brain development, preceding myelination. These isoforms potentially function as components of transcriptional complexes, contributing to intricate cellular processes. Moreover, members of the non-classic group may participate in signaling pathways within T-cells and neural cells. The extensive repertoire of isomers resulting from differential splicing events and optional post-translational modifications adds complexity, with each isomer potentially serving specialized functions. The MBP protein forms homodimers, further contributing to its diverse functional roles.

Mouse

E. coli

N-8*His

P04370 (M1-R250)

17196  [NCBI]

Full Length

MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR

30-40 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, 1 mM DTT, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.