MBP Protein, Mouse (His)
Based on 1 Customer Validation
MBP proteins, especially the classical isoforms 4-13, dominate myelin membranes in the central nervous system and are critical for myelination and stability.In contrast, the non-canonical isoform 1-3/Golli-MBP may be involved in early brain development and contribute to transcriptional complexes that influence multiple cellular processes.MBP Protein, Mouse (His) is the recombinant mouse-derived MBP protein, expressed by E.coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MBP proteins, especially the classical isoforms 4-13, dominate myelin membranes in the central nervous system and are critical for myelination and stability.In contrast, the non-canonical isoform 1-3/Golli-MBP may be involved in early brain development and contribute to transcriptional complexes that influence multiple cellular processes.MBP Protein, Mouse (His) is the recombinant mouse-derived MBP protein, expressed by E.coli , with N-His labeled tag.
The classic group of MBP isoforms (isoform 4-isoform 13) stands as the predominant protein constituents alongside PLP in the myelin membrane of the central nervous system (CNS), playing vital roles in both the formation and stabilization of the myelin sheath. Conversely, the non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may be particularly involved in the early stages of brain development, preceding myelination. These isoforms potentially function as components of transcriptional complexes, contributing to intricate cellular processes. Moreover, members of the non-classic group may participate in signaling pathways within T-cells and neural cells. The extensive repertoire of isomers resulting from differential splicing events and optional post-translational modifications adds complexity, with each isomer potentially serving specialized functions. The MBP protein forms homodimers, further contributing to its diverse functional roles.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-8*His
-
Accession
P04370 (M1-R250)
-
Molecular Construction
-
N-term
-
8*His
-
MBP (M1-R250)
Accession # P04370 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MBP; Myelin A1 Protein; Myelin Basic Protein; Golli-MBP; Myelin Membrane Encephalitogenic Protein
-
AA Sequence
MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 1 mM DTT, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
