1. Recombinant Proteins
  2. Others
  3. MBP Protein, Mouse (His)

MBP proteins, especially the classical isoforms 4-13, dominate myelin membranes in the central nervous system and are critical for myelination and stability.In contrast, the non-canonical isoform 1-3/Golli-MBP may be involved in early brain development and contribute to transcriptional complexes that influence multiple cellular processes.MBP Protein, Mouse (His) is the recombinant mouse-derived MBP protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MBP proteins, especially the classical isoforms 4-13, dominate myelin membranes in the central nervous system and are critical for myelination and stability.In contrast, the non-canonical isoform 1-3/Golli-MBP may be involved in early brain development and contribute to transcriptional complexes that influence multiple cellular processes.MBP Protein, Mouse (His) is the recombinant mouse-derived MBP protein, expressed by E.coli , with N-His labeled tag.

Background

The classic group of MBP isoforms (isoform 4-isoform 13) stands as the predominant protein constituents alongside PLP in the myelin membrane of the central nervous system (CNS), playing vital roles in both the formation and stabilization of the myelin sheath. Conversely, the non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may be particularly involved in the early stages of brain development, preceding myelination. These isoforms potentially function as components of transcriptional complexes, contributing to intricate cellular processes. Moreover, members of the non-classic group may participate in signaling pathways within T-cells and neural cells. The extensive repertoire of isomers resulting from differential splicing events and optional post-translational modifications adds complexity, with each isomer potentially serving specialized functions. The MBP protein forms homodimers, further contributing to its diverse functional roles.

Species

Mouse

Source

E. coli

Tag

N-8*His

Accession

P04370 (M1-R250)

Gene ID
Molecular Construction
N-term
8*His
MBP (M1-R250)
Accession # P04370
C-term
Protein Length

Full Length

Synonyms
MBP; Hmbpr; MGC99675; mld; Myelin A1 ; myelin basic; shi
AA Sequence

MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 1 mM DTT, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MBP Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MBP Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MBP Protein, Mouse (His)
Cat. No.:
HY-P77995
Quantity:
MCE Japan Authorized Agent: