NLRP1 Protein, Human

Customer Review

Based on 1 Customer Validation

The NLRP1 protein is a key sensor in the NLRP1 inflammasome and can trigger pyroptosis in response to multiple pathogen-related signals. It acts as a pattern recognition receptor (PRR), recognizes pathogens and damage-related signals, and initiates inflammasome complex formation and CASP1 activation. NLRP1 Protein, Human is the recombinant human-derived NLRP1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NLRP1 protein is a key sensor in the NLRP1 inflammasome and can trigger pyroptosis in response to multiple pathogen-related signals. It acts as a pattern recognition receptor (PRR), recognizes pathogens and damage-related signals, and initiates inflammasome complex formation and CASP1 activation. NLRP1 Protein, Human is the recombinant human-derived NLRP1 protein, expressed by E. coli , with tag free.

Background

The NLRP1 protein serves as the pivotal sensor component within the NLRP1 inflammasome, orchestrating inflammasome activation in response to diverse pathogen-associated signals. This activation culminates in pyroptosis, a critical cellular defense mechanism. Inflammasomes, supramolecular complexes that assemble in the cytosol, play indispensable roles in innate immunity and inflammation. Functioning as a recognition receptor (PRR), NLRP1 discerns specific pathogens and damage-associated signals, including cleavage by certain human enteroviruses, double-stranded RNA, UV-B irradiation, and Val-boroPro inhibitor. Upon detection, NLRP1 initiates the formation of the inflammasome polymeric complex, consisting of NLRP1, CASP1, and PYCARD/ASC. In response to pathogen-associated cues, the N-terminal portion of NLRP1 undergoes proteasomal degradation, liberating the cleaved C-terminal segment. This C-terminal fragment polymerizes and associates with PYCARD/ASC, instigating the inflammasome complex formation. The NLRP1 inflammasome recruits pro-caspase-1, fostering CASP1 activation, subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), ultimately inducing pyroptosis. In the absence of GSDMD expression, the NLRP1 inflammasome recruits and activates CASP8, leading to the activation of gasdermin-E (GSDME). Activation of the NLRP1 inflammasome is also crucial for HMGB1 secretion, amplifying inflammatory responses. NLRP1 additionally binds ATP, displaying ATPase activity, playing a pivotal role in antiviral immunity and inflammation in the human airway epithelium. It recognizes various pathogen-associated signals, such as HRV-14 and HRV-16 infection, positive-strand RNA viruses, and long dsRNA, acting as a direct sensor for RNA virus infection. Furthermore, NLRP1 may be activated by muramyl dipeptide (MDP) in a NOD2-dependent manner. UV-B irradiation causing ribosome collisions activates the NLRP1 inflammasome, and it functions as the precursor of the inflammasome, mediating autoproteolytic processing within the FIIND domain to generate N-terminal and C-terminal segments, which associate non-covalently in the absence of pathogens and other damage-associated signals.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • NLRP1 (L1379-K1462)
      Accession # Q9C000
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NLRP1; Nucleotide-Binding Domain And Caspase Recruitment Domain; Prev. NALP1; DKFZp586O1822; Prev. SLEV1; Systemic Lupus Erythematosus, Vitiligo-Related 1; DEFCAP; NACHT, Leucine Rich Repeat And PYD Containing 1; CARD7; NACHT, LRR And PYD Containing Prote

  • AA Sequence

    LHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEK

  • Predicted Molecular Mass

    10.1 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00