NLRP1 Protein, Human
Based on 1 Customer Validation
The NLRP1 protein is a key sensor in the NLRP1 inflammasome and can trigger pyroptosis in response to multiple pathogen-related signals. It acts as a pattern recognition receptor (PRR), recognizes pathogens and damage-related signals, and initiates inflammasome complex formation and CASP1 activation. NLRP1 Protein, Human is the recombinant human-derived NLRP1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The NLRP1 protein is a key sensor in the NLRP1 inflammasome and can trigger pyroptosis in response to multiple pathogen-related signals. It acts as a pattern recognition receptor (PRR), recognizes pathogens and damage-related signals, and initiates inflammasome complex formation and CASP1 activation. NLRP1 Protein, Human is the recombinant human-derived NLRP1 protein, expressed by E. coli , with tag free.
The NLRP1 protein serves as the pivotal sensor component within the NLRP1 inflammasome, orchestrating inflammasome activation in response to diverse pathogen-associated signals. This activation culminates in pyroptosis, a critical cellular defense mechanism. Inflammasomes, supramolecular complexes that assemble in the cytosol, play indispensable roles in innate immunity and inflammation. Functioning as a recognition receptor (PRR), NLRP1 discerns specific pathogens and damage-associated signals, including cleavage by certain human enteroviruses, double-stranded RNA, UV-B irradiation, and Val-boroPro inhibitor. Upon detection, NLRP1 initiates the formation of the inflammasome polymeric complex, consisting of NLRP1, CASP1, and PYCARD/ASC. In response to pathogen-associated cues, the N-terminal portion of NLRP1 undergoes proteasomal degradation, liberating the cleaved C-terminal segment. This C-terminal fragment polymerizes and associates with PYCARD/ASC, instigating the inflammasome complex formation. The NLRP1 inflammasome recruits pro-caspase-1, fostering CASP1 activation, subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), ultimately inducing pyroptosis. In the absence of GSDMD expression, the NLRP1 inflammasome recruits and activates CASP8, leading to the activation of gasdermin-E (GSDME). Activation of the NLRP1 inflammasome is also crucial for HMGB1 secretion, amplifying inflammatory responses. NLRP1 additionally binds ATP, displaying ATPase activity, playing a pivotal role in antiviral immunity and inflammation in the human airway epithelium. It recognizes various pathogen-associated signals, such as HRV-14 and HRV-16 infection, positive-strand RNA viruses, and long dsRNA, acting as a direct sensor for RNA virus infection. Furthermore, NLRP1 may be activated by muramyl dipeptide (MDP) in a NOD2-dependent manner. UV-B irradiation causing ribosome collisions activates the NLRP1 inflammasome, and it functions as the precursor of the inflammasome, mediating autoproteolytic processing within the FIIND domain to generate N-terminal and C-terminal segments, which associate non-covalently in the absence of pathogens and other damage-associated signals.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9C000 (L1379-K1462)
-
Gene ID/
-
Molecular Construction
-
N-term
-
NLRP1 (L1379-K1462)
Accession # Q9C000 -
C-term
-
-
Protein Length
Partial
-
Synonyms
NLRP1; Nucleotide-Binding Domain And Caspase Recruitment Domain; Prev. NALP1; DKFZp586O1822; Prev. SLEV1; Systemic Lupus Erythematosus, Vitiligo-Related 1; DEFCAP; NACHT, Leucine Rich Repeat And PYD Containing 1; CARD7; NACHT, LRR And PYD Containing Prote
-
AA Sequence
LHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEK
-
Predicted Molecular Mass
10.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)