PPP1CB Protein, Human (His)
Based on 1 Customer Validation
PPP1CB Protein, Human (His) is the recombinant human-derived PPP1CB, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PPP1CB Protein, Human (His) is the recombinant human-derived PPP1CB, expressed by E. coli , with N-6*His labeled tag.
PP1α/β is a protein phosphatase that forms highly specific holoenzymes by associating with over 200 regulatory proteins, targeting hundreds of biological substrates for dephosphorylation. It plays essential roles in cell division, glycogen metabolism, muscle contractility, and protein synthesis, while also regulating ionic conductances and long-term synaptic plasticity. As part of the PTW/PP1 phosphatase complex, PP1α/β contributes to chromatin structure modulation and cell cycle progression during the mitosis-to-interphase transition. Together with CSNK1D and CSNK1E, it determines circadian period length by regulating the phosphorylation rhythm and speed of PER1 and PER2. It may dephosphorylate CSNK1D and CSNK1E. In rheumatoid arthritis patients' regulatory T-cells (Treg), PP1α/β inactivates FOXP3 by dephosphorylating its 'Ser-418' residue, impairing Treg function. Additionally, PP1α/β serves as the core component of the SHOC2-MRAS-PP1c (SMP) holophosphatase complex, which stimulates MAPK pathway activation by dephosphorylating inhibitory sites ('Ser-259' of RAF1, 'Ser-365' of BRAF, and 'Ser-214' of ARAF), enhancing PP1c's substrate specificity and activity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P62140 (A2-R327)
-
Gene ID5500
-
Molecular Construction
-
N-term
-
6*His
-
PPP1CB (A2-R327)
Accession # P62140 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PPP1CB; Myosin Phosphatase; Protein Phosphatase 1 Catalytic Subunit Beta; PP1Cdelta; PP-1B; PP1Cbeta; PPP1beta; Protein Phosphatase 1, Catalytic Subunit, Beta Isoform; PP1beta; Epididymis Secretory Sperm Binding Protein Li 80p; PPP1CD; Protein-Serine/Thre
-
AA Sequence
ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
-
Predicted Molecular Mass
37.9 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
