1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PPP1CB Protein, Human (His)

PPP1CB Protein, Human (His) is the recombinant human-derived PPP1CB, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg Get quote
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PPP1CB Protein, Human (His) is the recombinant human-derived PPP1CB, expressed by E. coli , with N-6*His labeled tag.

Background

PP1α/β is a protein phosphatase that forms highly specific holoenzymes by associating with over 200 regulatory proteins, targeting hundreds of biological substrates for dephosphorylation. It plays essential roles in cell division, glycogen metabolism, muscle contractility, and protein synthesis, while also regulating ionic conductances and long-term synaptic plasticity. As part of the PTW/PP1 phosphatase complex, PP1α/β contributes to chromatin structure modulation and cell cycle progression during the mitosis-to-interphase transition. Together with CSNK1D and CSNK1E, it determines circadian period length by regulating the phosphorylation rhythm and speed of PER1 and PER2. It may dephosphorylate CSNK1D and CSNK1E. In rheumatoid arthritis patients' regulatory T-cells (Treg), PP1α/β inactivates FOXP3 by dephosphorylating its 'Ser-418' residue, impairing Treg function. Additionally, PP1α/β serves as the core component of the SHOC2-MRAS-PP1c (SMP) holophosphatase complex, which stimulates MAPK pathway activation by dephosphorylating inhibitory sites ('Ser-259' of RAF1, 'Ser-365' of BRAF, and 'Ser-214' of ARAF), enhancing PP1c's substrate specificity and activity.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P62140 (A2-R327)

Gene ID

5500

Molecular Construction
N-term
6*His
PPP1CB (A2-R327)
Accession # P62140
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Serine/threonine-protein phosphatase PP1-beta catalytic subunit; PP-1B; PPP1CD; EC:3.1.3.16; EC:3.1.3.53
AA Sequence

ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

Predicted Molecular Mass
37.9 kDa
Molecular Weight

Approximately 38 kDa,based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PPP1CB Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PPP1CB Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPP1CB Protein, Human (His)
Cat. No.:
HY-P703359
Quantity:
MCE Japan Authorized Agent: