S100A3 Protein, Mouse (His)
Based on 1 Customer Validation
S100A3 Protein, acting as a homodimer with disulfide linkages, exhibits strong binding affinity for beta-galactoside and lactose.Notably, it potently induces T-cell apoptosis, as demonstrated in various studies, and displays hemagglutinating activity towards chicken erythrocytes.These properties underscore S100A3's multifaceted roles in cellular interactions and immune modulation.S100A3 Protein, Mouse (His) is the recombinant mouse-derived S100A3 protein, expressed by E.coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
S100A3 Protein, acting as a homodimer with disulfide linkages, exhibits strong binding affinity for beta-galactoside and lactose.Notably, it potently induces T-cell apoptosis, as demonstrated in various studies, and displays hemagglutinating activity towards chicken erythrocytes.These properties underscore S100A3's multifaceted roles in cellular interactions and immune modulation.S100A3 Protein, Mouse (His) is the recombinant mouse-derived S100A3 protein, expressed by E.coli , with N-His labeled tag.
Galectin-13, acting as a homodimer through disulfide linkages, demonstrates binding affinity for beta-galactoside and lactose. Additionally, it serves as a potent inducer of T-cell apoptosis, as evidenced by various studies. Moreover, Galectin-13 exhibits hemagglutinating activity specifically towards chicken erythrocytes. These properties highlight its multifaceted roles in cellular interactions and immune modulation.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P62818 (M1-Q101)
-
Molecular Construction
-
N-term
-
His
-
S100A3 (M1-Q101)
Accession # P62818 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A3; S100 Calcium-Binding Protein A3; Prev. S100E; Protein S-100E; S100 Calcium Binding Protein A3; Protein S100-A3
-
AA Sequence
MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
