SNCB Protein, Human (His)
SNCB Protein, Human (His) is the recombinant human-derived SNCB, expressed by E. coli , with His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SNCB Protein, Human (His) is the recombinant human-derived SNCB, expressed by E. coli , with His labeled tag. ,
SNCB is a non-amyloid component of senile plaques found in Alzheimer disease. It may act as a regulator of the SNCA aggregation process and protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Additionally, SNCB contributes to restoring the SNCA anti-apoptotic function abolished by 6OHDA but is not found in the Lewy bodies associated with Parkinson disease.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag His
-
Accession
Q16143 (M1-A134)
-
Gene ID6620
-
Protein Length
Full Length
-
Synonyms
SNCB; I(2)-Synuclein; Synuclein Beta; Β-Synuclein; Beta-Synuclein
-
AA Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
-
Predicted Molecular Mass
19 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
