TPPP2 Protein, Human (His)
Based on 1 Customer Validation
The TPPP2 protein may be a regulator of microtubule dynamics and is critical for sperm motility. Unlike other family members, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role. TPPP2 Protein, Human (His) is the recombinant human-derived TPPP2 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The TPPP2 protein may be a regulator of microtubule dynamics and is critical for sperm motility. Unlike other family members, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role. TPPP2 Protein, Human (His) is the recombinant human-derived TPPP2 protein, expressed by E. coli , with N-His labeled tag.
The TPPP2 protein emerges as a probable regulator of microtubule dynamics crucial for sperm motility. In contrast to other members of its protein family, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role within microtubule-associated processes. Its involvement in regulating microtubule dynamics underscores its significance in orchestrating the complex machinery required for sperm motility. Further investigation into the specific molecular mechanisms governed by TPPP2 and its distinct characteristics within the microtubule regulatory landscape will contribute to a more comprehensive understanding of its role in facilitating sperm motility.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P59282 (M1-K170)
-
Gene ID122664 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
TPPP2 (M1-K170)
Accession # P59282 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TPPP2; P18; Prev. C14orf8; Protein P25-Beta; P25beta; TPPP/P18; CT152; Chromosome 14 Open Reading Frame 8; Tubulin Polymerization Promoting Protein Family Member 2; Tubulin Polymerization-Promoting Protein Family Member 2
-
AA Sequence
MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK
-
Predicted Molecular Mass
19 kDa
-
Molecular Weight
Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
