VAPB Protein, Human (His)
Based on 1 Customer Validation
VAPB protein interacts with STARD3 through a phosphorylation-dependent mechanism to form a contact site between the endoplasmic reticulum (ER) and late endosomes. VAPB Protein, Human (His) is the recombinant human-derived VAPB protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
VAPB protein interacts with STARD3 through a phosphorylation-dependent mechanism to form a contact site between the endoplasmic reticulum (ER) and late endosomes. VAPB Protein, Human (His) is the recombinant human-derived VAPB protein, expressed by E. coli , with C-6*His labeled tag.
VAPB Protein, an endoplasmic reticulum-anchored protein, plays a crucial role in the formation of contact sites between the endoplasmic reticulum (ER) and late endosomes through its interaction with STARD3 in a phosphorylation-dependent manner of the FFAT motif. Beyond its structural involvement, VAPB contributes to the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Additionally, it is implicated in the regulation of cellular calcium homeostasis. VAPB exists as a homodimer and forms heterodimers with VAPA. Its interactome extends to include proteins such as VAMP1, VAMP2, ZFYVE27, RMDN3, KIF5A, STARD3, STARD3NL, CERT1, PLEKHA3, SACM1L, and VPS13A, underscoring its versatility in participating in diverse cellular processes. The interactions with RB1CC1, MIGA2, OSBPL1A, KCNB1, and KCNB2, involving phosphorylated FFAT motifs, highlight the intricate regulatory networks in which VAPB is engaged. This comprehensive network of interactions emphasizes the pivotal role of VAPB in coordinating essential cellular processes at the ER-endosome interface.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
O95292 (A2-P132)
-
Molecular Construction
-
N-term
-
VAPB (A2-P132)
Accession # O95292 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
VAPB; VAMP Associated Protein B And C; VAMP (Vesicle‑Associated Membrane Protein)‑Associated Protein B And C; VAP‑B; ALS8; Vesicle‑Associated Membrane Protein‑Associated Protein B/C; VAP‑C; CDNA FLJ13179 Fis, Clone NT2RP3003918, Highly Similar To Vesicle‑
-
AA Sequence
AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKP
-
Predicted Molecular Mass
16 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
