1. Peptides

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 

Cat. No.: HY-P1227 Purity: 95.96%
Handling Instructions

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Chemical Structure

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Chemical Structure

Size Price Stock Quantity
1 mg USD 420 In-stock
Estimated Time of Arrival: December 31
5 mg USD 1320 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Technical Information

  • Purity & Documentation

Description

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide.

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
Molecular Weight

3443.87

Sequence

Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

Sequence Shortening

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Storage
Protect from light
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Shipping

Room temperature in continental US; may vary elsewhere

  • 不竞价 何超庆 分子量供应商提供
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Cat. No.:
HY-P1227
Quantity:

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Cat. No.: HY-P1227