srtA Protein, S. aureus
Based on 1 Customer Validation
srtA Protein, S. aureus is the recombinant srtA protein, expressed by E. coli, with tag free tag.
- Species: Others
- Source: E. coli
-
Speicherung:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biologische Aktivität
srtA Protein, S. aureus is the recombinant srtA protein, expressed by E. coli, with tag free tag.
srtA is a transpeptidase that anchors surface proteins to the cell wall. It recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal, forming a covalent intermediate via a thioester bond between the sortase and its substrate, which is then transferred and attached to the cell wall. This enzyme cleaves the Leu-Pro-x-Thr-Gly (LPXTG) motif between the threonine and glycine residues and utilizes lipid II as the peptidoglycan substrate for the sorting reaction. It is responsible for displaying virulence factors and plays a key role in host interactions and colonization during infection. by similar: This function is consistently reported across multiple studies.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
Q2FV99 (Q60-K206, P94S, D160N, D165A, G167E, K196T)
-
Gene ID3921273
-
Protein Length
Partial
-
Synonyms
Sortase A; EC:3.4.22.70; Surface protein sorting A; srtA; SAOUHSC_02834
-
AA Sequence
QAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATSEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVEVLDEQKGKDKQLTLITCDDYNEKTGVWETRKIFVATEVK
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Reinheit
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 8.0, 500 mM NaCl, 5% glycerol.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Powered by Bioz
