Cagrilintide acetate
Based on 3 publication(s) in Google Scholar
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 99.96%
- Formule: C194H312N54O59S2.xC2H4O2
- Masse moléculaire:4409.01 (free base)
-
Stockage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications Citing Use of MedChemExpress (MCE) Cagrilintide acetate
More
Activité biologique
Cagrilintide acetate (10 nmol/kg; i.v. or s.c.; single) shows good pharmacokinetic parameters[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague Dawley male rats (12-week-old; ~400 g)[1]
-
Dosage:0.1, 1, 3, 10, 30 nmol/kg
-
Administration:Subcutaneous injection; single
-
Result:Reduced food intake in the rat for several days at doses in the range of 1-10 nmol/kg.
-
Animal Model:Sprague Dawley male rats (12-week-old; ~400 g)[1]
-
Dosage:10 nmol/kg
-
Administration:Intravenous injection or subcutaneous injection; single
-
Result:Showed good pharmacokinetic parameters with T1/2 of 20, 27 h for i.v. and s.c., respectively.
Chemical Information
-
Appearance Solid
-
Masse moléculaire 4409.01 (free base)
-
Formule C194H312N54O59S2.xC2H4O2
-
Color White to off-white
-
Sequence
{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
-
Sequence Shortening
{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (3)
Solvant et solubilité
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 50 mg/mL (Need ultrasonic)
Pureté et documentation
-
Fiche technique (292 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Kruse T, et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. J Med Chem. 2021 Aug 12;64(15):11183-11194. [Content Brief]
[2]. Fletcher MM, et al. AM833 Is a Novel Agonist of Calcitonin Family G Protein-Coupled Receptors: Pharmacological Comparison with Six Selective and Nonselective Agonists. J Pharmacol Exp Ther. 2021 Jun;377(3):417-440. [Content Brief]
[3]. Dehestani B, et al. Amylin as a Future Obesity Treatment. J Obes Metab Syndr. 2021 Dec 30;30(4):320-325. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)