country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P4744A

Copy Link Print Information

LL-37 amide TFA

2 Cited Publications

Avis client

Based on 2 publication(s) in Google Scholar

LL-37 amide TFA is a selective agonist of formyl peptide receptor-like FPRL1, effectively inhibiting periodontal pathogens (ED₉₉=8.5-8.7 μg/mL). LL-37 amide TFA exerts its bactericidal effect by activating FPRL1-mediated immune cell chemotaxis and disrupting bacterial cell membrane integrity. It can also regulate inflammatory responses (inhibiting the release of factors such as TNF-α) and promote angiogenesis. Amidation modification reduces its sensitivity to serum inhibition and improves its stability. LL-37 amide TFA possesses key activities in bactericidal action, immunomodulation, and wound healing, and is mainly used in research on infection-related diseases such as periodontal disease and deep tissue injuries (pressure ulcers), and wound healing.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Pureté: 99.97%
Formule: C₂₀₅H₃₄₁N₆₁O₅₂.xC₂HF₃O₂
Masse moléculaire:4492.28 (free base)

Stockage:

Sealed storage, away from moisture and light.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

LL-37 amide TFA Chemical Structure

Size

Prix

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique
- Description
- In Vitro
- In Vivo
Chemical Information
Publications (2)
Solvant et solubilité
- In Vitro
Pureté et documentation
Références
Calculators
Help & FAQs
Classifications
Bioz

Activité biologique

Description

In Vitro

LL-37 amide TFA is the carboxyl-terminal amidated form of LL-37. Compared to natural LL-37, it exhibits significantly improved stability and enhanced resistance to enzymatic degradation^[1].
Antibacterial activity: It shows good antibacterial effects against both Gram-positive bacteria (such as *Bacillus megaterium*) and Gram-negative bacteria (such as *Escherichia coli* D21). The MIC against D21 is approximately 5 μM, comparable to that of natural LL-37^[1].
Cytotoxicity: The toxicity to eukaryotic cells is concentration-dependent, with a safe concentration range of 0.1-10 μM. Toxicity increases significantly at concentrations above 10 μM^[1].
LL-37 amide TFA (8.5-8.7 μg/mL; 1 h) exhibits bactericidal activity against *Actinobacillus actinomycetemcomitans* FDC-Y4 and *Porphyromonas gingivalis* ATCC 33123, with ED₉₉ values ??of 8.7 μg/mL and 8.5 μg/mL, respectively^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

In vivo experiments often use natural LL-37 (free carboxyl form) rather than LL-37 amide TFA. It is recommended to select models related to the in vitro activity of LL-37 amide TFA, such as skin infection models, wound healing models, and inflammation models, as directions for further research. For example, in a Staphylococcus aureus skin infection model in BALB/c mice, 10 μg of LL-37 amide TFA was applied topically (in combination with a chitosan hydrogel). The results showed that the LL-37 amide TFA-chitosan hydrogel significantly accelerated wound healing, improved bacterial clearance, and reduced inflammatory responses, with better results than free LL-37^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Chemical Information

Appearance Solid
Masse moléculaire 4492.28 (free base)
Formule C₂₀₅H₃₄₁N₆₁O₅₂.xC₂HF₃O₂
Color White to off-white
Sequence

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
Sequence Shortening

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2
Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Publications (2)

All

Sort by:

Journal Impact Factor

Eur J Pharmacol

Systemic administration of Neochamaejasmin B inhibits mast cell activation to reduce inflammation in a rosacea mouse model by targeting MRGPRX2. [Abstract]

2025 Sep 15:1003:177988. PMID: 40706973
Res Sq

2026 Jan 27.

Solvant et solubilité

In Vitro:

DMSO : 50 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

View the Complete Stock Solution Preparation Table

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (270 KB)
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Papo N, et al. New lytic peptides based on the D,L-amphipathic helix motif preferentially kill tumor cells compared to normal cells. Biochemistry. 2003;42(31):9346-9354. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

LL-37 amide TFA

2 Cited Publications

100 mg Obtenir un devis

Subscribe to the

MedChemExpress

Newsletter

MOQ

Minimum order quantity

100 mg

Obtenir un devis En stock

Other size

Obtenir un devis

Amount: USD 0.00

Activité biologique
- Description
- In Vitro
- In Vivo
Chemical Information
Publications (2)
Solvant et solubilité
- In Vitro
Pureté et documentation
Références

Nom du produit:
Cat. No.:
Quantité:
MCE Japan Authorized Agent:

Nom du produit:
CAS No.:
Species:
Pureté:
Quantité:

LL-37 amide TFA

Peptide Library

Publications Citing Use of MedChemExpress (MCE) LL-37 amide TFA

Activité biologique

Chemical Information

Publications (2)

Solvant et solubilité

Pureté et documentation

Références

Calculators

Help & FAQs

LL-37 amide TFA

Peptide Library

Publications Citing Use of MedChemExpress (MCE) LL-37 amide TFA

Activité biologique

Chemical Information

Publications (2)

Solvant et solubilité

Pureté et documentation

Références

Calculators

Help & FAQs

LL-37 amide TFA Related Classifications

HY-P4744A Related Classifications