FGF basic Protein, Salmon

Kundenbewertung

Based on 1 Customer Validation

FGF basic Protein, Salmon is the recombinant FGF-basic protein, expressed by E. coli, with tag free.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
  • Species: Others
  • Source: E. coli
  • Speicherung:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biologische Aktivität
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biologische Aktivität

Beschreibung

FGF basic Protein, Salmon is the recombinant FGF-basic protein, expressed by E. coli, with tag free.

Verified Bioactivity

Measure by its ability by a dose-response proliferation assay using murine Balb/c 3T3 cells. The ED50 for this effect is <1 ng/mL. The specific activity of this protein is > 1.0 × 106 IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FGF basic (M1-R155)
      Accession # XP_035600424.1
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2; FGF2; FGFB

  • AA Sequence

    MATGEITTLPATPEDGGSGGFPPGNFKEPKRLYCKNGGYFLRINSNGSVDGIREKNDPHIKLQLQATSVGEVVIKGVSANRYLAMNGDGRLFGTRRTTDECYFMERLESNNYNTYRSRKYPDMYVALKRTGQHKSGSKTGPGQKAILFLPMSARR

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under non reducing (N) conditions.

  • Reinheit

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 7.8 mM Na2HPO4, 1.5 mM KH2PO4, 2.7 mM KCl, 500 mM NaCl.

Endotoxin Level

< 0.2 EU/μg of protein by gel clotting method

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Verdünnungsrechner

Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)

Konzentration (Stammlösung) Konzentration (Stammlösung)
×
Volumen (Stammlösung) Volumen (Stammlösung)
=
Konzentration (Ziellösung) Konzentration (Ziellösung)
×
Volumen (Ziellösung) Volumen (Ziellösung)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Angebot einholen Auf Lager

Other size
Angebot einholen
Please select quantity
Amount: USD 0.00