Corticotropin-releasing factor (Sheep)  (Synonyms: CRH (Sheep))

Corticotropin-releasing factor (CRH) (Sheep) is a brain-penetrant hypothalamic releasing factor and a peptide hormone with analgesic and arousal-inducing activity. Corticotropin-releasing factor (Sheep) mediates stress effects, including stress-induced analgesia. Corticotropin-releasing factor (Sheep) increases wakefulness, reduces slow wave sleep, alters EEG frequency content, stimulates ACTH and β-endorphin release, activates locomotor activity. Corticotropin-releasing factor (Sheep) can be used for the research of neurological disease^[1][2].

Corticotropin-releasing factor (Sheep) (4-32 μg; i.v.; single dose) produces analgesia in male Wistar rats tested via the tail flick test^[1].
Corticotropin-releasing factor (Sheep) (23-118 μg/kg; i.v.; single dose) produces analgesia in male SD rats tested via the hot plate test, with an ED₅₀ of 10 nmol/kg^[1].
Corticotropin-releasing factor (Sheep) (4-14 μg; i.v.; single dose or 0.4-2.5 μg; intradermal into hindpaw; single dose) produces analgesia in anaesthetized male albino rats tested via the paw flick assay with 48°C water immersion^[1].
Corticotropin-releasing factor (Sheep) (10-40 μg/kg; i.v.; single dose or 100-200 ng; intracisternal; single dose) produces analgesia in female Std:ddy mice tested via the phenylquinone writhing assay^[1].
Corticotropin-releasing factor (Sheep) (29-86 μg/kg; i.v.; single dose) produces antinociception in anaesthetized male SD rats, with an ED₅₀ of 2.3-7 nmol/kg, as measured by reduced trigeminal neuron responses to noxious heat^[1].
Corticotropin-releasing factor (Sheep) (0.1-1.5 ng; intraplantar into inflamed hindpaw; single dose) reduces CFA-induced hyperalgesia in the inflamed hindpaw of male Wistar rats, with an ED₅₀ of 1.59 ng, via a mechanism involving immune cell-derived β-endorphin^[1].
Corticotropin-releasing factor (Sheep) (0.7 μg; i.c.v.; single dose) produces analgesia in male Wistar rats tested via the formalin test^[1].
Corticotropin-releasing factor (Sheep) (0.0015-0.015 nmol; i.c.v.; single injection) produces dose-dependent increases in arousal, marked by 91.3% and 93.8% reductions in slow wave sleep time, respectively, and corresponding shifts in cortical EEG frequency power in male Sprague-Dawley rats^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4670.31

C₂₀₅H₃₃₉N₅₉O₆₃S

9015-71-8

Solid

White to off-white

Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

• [1]. Lariviere WR, et al. The role of corticotropin-releasing factor in pain and analgesia. Pain. 2000;84(1):1-12.  [Content Brief]

  [2]. Ehlers CL, et al. Effects of corticotropin-releasing factor and growth hormone-releasing factor on sleep and activity in rats. Neuroendocrinology. 1986;42(6):467-474.  [Content Brief]