Corticotropin-releasing factor (Sheep)
Based on 1 Customer Validation
Corticotropin-releasing factor (CRH) (Sheep) is a brain-penetrant hypothalamic releasing factor and a peptide hormone with analgesic and arousal-inducing activity. Corticotropin-releasing factor (Sheep) mediates stress effects, including stress-induced analgesia. Corticotropin-releasing factor (Sheep) increases wakefulness, reduces slow wave sleep, alters EEG frequency content, stimulates ACTH and β-endorphin release, activates locomotor activity. Corticotropin-releasing factor (Sheep) can be used for the research of neurological disease.
For research use only. We do not sell to patients.
- Purity : 99.58%
- CAS No.: 9015-71-8
- Formula: C205H339N59O63S
- Molecular Weight:4670.31
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
In Vivo
Corticotropin-releasing factor (Sheep) (23-118 μg/kg; i.v.; single dose) produces analgesia in male SD rats tested via the hot plate test, with an ED50 of 10 nmol/kg[1].
Corticotropin-releasing factor (Sheep) (4-14 μg; i.v.; single dose or 0.4-2.5 μg; intradermal into hindpaw; single dose) produces analgesia in anaesthetized male albino rats tested via the paw flick assay with 48°C water immersion[1].
Corticotropin-releasing factor (Sheep) (10-40 μg/kg; i.v.; single dose or 100-200 ng; intracisternal; single dose) produces analgesia in female Std:ddy mice tested via the phenylquinone writhing assay[1].
Corticotropin-releasing factor (Sheep) (29-86 μg/kg; i.v.; single dose) produces antinociception in anaesthetized male SD rats, with an ED50 of 2.3-7 nmol/kg, as measured by reduced trigeminal neuron responses to noxious heat[1].
Corticotropin-releasing factor (Sheep) (0.1-1.5 ng; intraplantar into inflamed hindpaw; single dose) reduces CFA-induced hyperalgesia in the inflamed hindpaw of male Wistar rats, with an ED50 of 1.59 ng, via a mechanism involving immune cell-derived β-endorphin[1].
Corticotropin-releasing factor (Sheep) (0.7 μg; i.c.v.; single dose) produces analgesia in male Wistar rats tested via the formalin test[1].
Corticotropin-releasing factor (Sheep) (0.0015-0.015 nmol; i.c.v.; single injection) produces dose-dependent increases in arousal, marked by 91.3% and 93.8% reductions in slow wave sleep time, respectively, and corresponding shifts in cortical EEG frequency power in male Sprague-Dawley rats[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague-Dawley (SD) rats (male)[1]
-
Dosage:23-118 μg/kg
-
Administration:i.v.; single dose
-
Result:Produced significant analgesia in the hot plate test at 118 μg/kg.
Produced analgesia with an ED50 of 10 nmol/kg at doses of 5-25.2 nmol/kg.
-
Animal Model:Sprague-Dawley (male, 200-350 g)[2]
-
Dosage:0.0015 nmol; 0.015 nmol
-
Administration:i.c.v.; single injection
-
Result:Reduced slow wave sleep (SWS) time by 91.3% to a mean of 5.8 ± 5.8% of the 30-minute scored epoch.
Decreased 1-2 Hz, 2-4 Hz, and 4-6 Hz cortical EEG power.
Increased 32-64 Hz cortical EEG power.
Reduced slow wave sleep (SWS) time by 93.8% to a mean of 3.4 ± 3.4% of the 30-minute scored epoch .
Decreased 16-32 Hz cortical EEG power.
Increased 32-64 Hz cortical EEG power.
Chemical Information
-
CAS No. 9015-71-8
-
Appearance Solid
-
Molecular Weight 4670.31
-
Formula C205H339N59O63S
-
Color White to off-white
-
Synonyms
CRH (Sheep)
-
Sequence
Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
-
Sequence Shortening
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : ≥ 2 mg/mL (0.43 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Purity & Documentation
-
Data Sheet (287 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Lariviere WR, et al. The role of corticotropin-releasing factor in pain and analgesia. Pain. 2000;84(1):1-12. [Content Brief]
[2]. Ehlers CL, et al. Effects of corticotropin-releasing factor and growth hormone-releasing factor on sleep and activity in rats. Neuroendocrinology. 1986;42(6):467-474. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)