2. Peptides
  3. Helospectin I

Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Helospectin I Chemical Structure

Helospectin I Chemical Structure

CAS No. : 93438-37-0

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Helospectin I Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum[1][2].

IC50 & Target

Vasoactive intestinal peptide (VIP)[1]
In Vitro

Helospectin I (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch[1].
Helospectin I relaxes the Phenylephrine-contracted rat femoral arteries with pEC50 of 6.82[2].
Helospectin I (0.1 nM-1 μM) inhibits the binding of 125I-labeled VIP and 125I-secretin to dispersed chief cells[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Helospectin I Related Antibodies
In Vivo

Helospectin I (0.03-2 nmol/kg, 100 μL of infusion at the left jugular vein) reduces blood pressure in rats[2].
Helospectin I (0.1-0.8 nmol /kg, i.v.) increases plasma levels of glucagon in mice[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: SD rats[2]
Dosage: 0.03, 0.3, 1, 2 nM/kg
Administration: 100 μL of infusion at the left jugular vein, followed by washing the catheter with 100 μL saline.
Result: Reduced the blood pressure, but was less effective than vasoactive intestinal peptide (VIP) in the low dose range.
Animal Model: Mice[3]
Dosage: 0.1, 0.2, 0.4, 0.8 nM /kg
Administration: Intravenous injection (i.v.)
Result: Markedly stimulated glucagon secretion, and had no direct action on insulin secretion.
Molecular Weight

4095.63

Formula

C183H293N47O59
CAS No.
Sequence Shortening

HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Helospectin I93438-37-0OthersVasodilatoryantihypertensiveblood pressureneuropeptidehamsterfemoral arterieschief cellInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Helospectin I
Cat. No.:
HY-P3053
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.