Helospectin II
Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin II is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- CAS No.: 93585-83-2
- Formule: C180H288N46O57
- Masse moléculaire:4008.55
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
Vasoactive intestinal peptide (VIP) receptor[1]
Helospectin II (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch[1].
Helospectin II relaxes the Phenylephrine-contracted rat femoral arteries with pEC50 of 6.93[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:SD rats[2]
-
Dosage:0.03, 0.3, 1, 2 nmol/kg
-
Administration:100 μL of infusion at the left jugular vein, followed by washing the catheter with 100 μL saline.
-
Result:Reduced the blood pressure, but was less effective than vasoactive intestinal peptide (VIP) in the low dose range.
Chemical Information
-
CAS No. 93585-83-2
-
Masse moléculaire 4008.55
-
Formule C180H288N46O57
-
Sequence
His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser
-
Sequence Shortening
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
[1]. Tsueshita T, et al. Helospectin I and II evoke vasodilation in the intact peripheral microcirculation. Peptides. 2004 Jan;25(1):65-9. [Content Brief]
[2]. Grundemar L, et al. Vascular effects of helodermin, helospectin I and helospectin II: a comparison with vasoactive intestinal peptide (VIP). Br J Pharmacol. 1990 Mar;99(3):526-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Helospectin II Related Classifications
HY-P3050 Related Classifications
Powered by Bioz