Helospectin II
Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin II is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.
For research use only. We do not sell to patients.
- CAS No.: 93585-83-2
- Formula: C180H288N46O57
- Molecular Weight:4008.55
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Vasoactive intestinal peptide (VIP) receptor[1]
Helospectin II (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch[1].
Helospectin II relaxes the Phenylephrine-contracted rat femoral arteries with pEC50 of 6.93[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:SD rats[2]
-
Dosage:0.03, 0.3, 1, 2 nmol/kg
-
Administration:100 μL of infusion at the left jugular vein, followed by washing the catheter with 100 μL saline.
-
Result:Reduced the blood pressure, but was less effective than vasoactive intestinal peptide (VIP) in the low dose range.
Chemical Information
-
CAS No. 93585-83-2
-
Molecular Weight 4008.55
-
Formula C180H288N46O57
-
Sequence
His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser
-
Sequence Shortening
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Tsueshita T, et al. Helospectin I and II evoke vasodilation in the intact peripheral microcirculation. Peptides. 2004 Jan;25(1):65-9. [Content Brief]
[2]. Grundemar L, et al. Vascular effects of helodermin, helospectin I and helospectin II: a comparison with vasoactive intestinal peptide (VIP). Br J Pharmacol. 1990 Mar;99(3):526-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz