ω-Agatoxin IVA
Based on 1 publication(s) in Google Scholar
ω-Agatoxin IVA is a potent, selective P/Q type Ca2+ (Cav2.1) channel blocker with IC50 values of 2 nM and 90 nM. ω-Agatoxin IVA inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA inhibits Capsaicin (HY-10448)-induced CGRP release and vasodilation. ω-Agatoxin IVA can be used for the research of neurological and cardiovascular disease.
For research use only. We do not sell to patients.
- Purity: 98.71%
- CAS No.: 145017-83-0
- Formula: C217H360N68O60S10
- Molecular Weight:5202.25
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) ω-Agatoxin IVA
MoreAll Calcium Channel Isoforms
More
Biological Activity
|
P/Q-type calcium channel |
ω-Agatoxin IVA potently inhibits somatic P-type calcium channels in rat cerebellar Purkinje neurons with an IC50 of 2 nM[1].
ω-Agatoxin IVA inhibits Q-type calcium channels in rat cerebellar granule neurons with an IC50 of 90 nM, which is 45-fold less potent than its activity against P-type channels[1].
ω-Agatoxin IVA inhibits high potassium-induced glutamate exocytosis and calcium influx in rat cortical synaptosomes with IC50 values ranging from 30 nM to 225 nM[1].
ω-Agatoxin IVA (200 nM) inhibits cloned rat brain rbA-I and rbA-II calcium channel isoforms by only 20%[1].
ω-Agatoxin IVA (100 nM) does not inhibit voltage-dependent calcium currents in cultured rat sympathetic neurons[2].
ω-Agatoxin IVA (100 nM; 30 min) does not alter frequency-dependent neurogenic excitatory responses in isolated rabbit pulmonary artery ring preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) does not significantly inhibit neurogenic cholinergic excitatory responses in isolated guinea-pig myenteric plexus preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) does not significantly inhibit neurogenic noradrenergic excitatory responses in isolated rat vas deferens preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) does not significantly inhibit neurogenic excitatory responses in isolated rat bladder strip preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) does not significantly inhibit neurogenic noradrenergic excitatory responses in isolated rat anococcygeus muscle preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) does not significantly alter neurogenic NANC inhibitory responses in isolated Atropine (HY-B1205)/Guanethidine (HY-B1251)-treated rat anococcygeus muscle and jejunum preparations preparations[2].
ω-Agatoxin IVA (0.1 μmol/L; 30 min) potently inhibits Capsaicin (HY-10448)-induced CGRP release from isolated rat pial arteries[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague-Dawley with Capsaicin-induced vasodilation (male, 250 to 300 g, 12 to 14 weeks old)[3]
-
Dosage:0.1 μmol/L
-
Administration:topical suffusion; 30 minutes before and during exposure/induction
-
Result:Caused a marginal 14.6% increase in baseline pial arterial diameter.
Significantly inhibited capsaicin-induced pial arterial vasodilation.
Increased the slope of the regression line for the vasodilation phase from -1.71 (vehicle) to -0.27.
Increased the slope for the vasoconstriction phase from -1.55 (vehicle) to -0.42.
Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala (Disulfide bridge:Cys4-Cys20,Cys12-Cys25,Cys19-Cys36,Cys27-Cys34)
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Disulfide bridge:Cys4-Cys20,Cys12-Cys25,Cys19-Cys36,Cys27-Cys34)
Chemical Information
-
CAS No. 145017-83-0
-
Appearance Solid
-
Molecular Weight 5202.25
-
Formula C217H360N68O60S10
-
Color White to off-white
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
Solvent & Solubility
DMSO : ≥ 100 mg/mL (19.22 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Please enter the basic information of animal experiments:
-
-
-
-
Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Working solution concentration: 0.22 mg/mL
Purity & Documentation
-
Data Sheet (312 KB)
-
SDS (393 KB)
- English - EN (393 KB)
- Français - FR (393 KB)
- Deutsch - DE (393 KB)
- Norwegian - NO (393 KB)
- Español - ES (393 KB)
- Swedish - SV (393 KB)
- Italian - IT (393 KB)
- Portuguese - PT (393 KB)
-
Handling Instructions (2659 KB)
References
[1]. Teramoto T, et al. A novel type of calcium channel sensitive to omega-agatoxin-TK in cultured rat cerebral cortical neurons. Brain Res. 1997;756(1-2):225-230. [Content Brief]
[2]. Lundy P M, Frew R. Effect of ω-agatoxin-IVA on autonomic neurotransmission[J]. European journal of pharmacology, 1994, 261(1-2): 79-84. [Content Brief]
[3]. Hong KW, et al. Effect of omega-conotoxin GVIA and omega-agatoxin IVA on the capsaicin-sensitive calcitonin gene-related peptide release and autoregulatory vasodilation in rat pial arteries. J Cereb Blood Flow Metab. 1999;19(1):53-60. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.1922 mL | 0.9611 mL | 1.9222 mL | 4.8056 mL |
| 5 mM | 0.0384 mL | 0.1922 mL | 0.3844 mL | 0.9611 mL | |
| 10 mM | 0.0192 mL | 0.0961 mL | 0.1922 mL | 0.4806 mL | |
| 15 mM | 0.0128 mL | 0.0641 mL | 0.1281 mL | 0.3204 mL |
ω-Agatoxin IVA Related Classifications
Cat. No.: HY-P1080
Powered by Bioz
- ω-Agatoxin IVA
- 145017-83-0
- Calcium Channel
- glutamate exocytosis
- rat cortical synaptosomes
- rat cerebellar Purkinje neurons
- calcitonin gene-related peptide
- P-type voltage-dependent calcium channels
- rat sympathetic neurons
- Q-type voltage-dependent calcium channels
- pial artery
- rat cerebellar granule neurons
- perivascular sensory nerve terminals
- Inhibitor
- inhibitor
- inhibit