ω-Agatoxin IVA TFA
Based on 1 publication(s) in Google Scholar
ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca2+ (Cav2.1) channel blocker with IC50 values of 2 nM and 90 nM. ω-Agatoxin IVA TFA inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA inhibits Capsaicin (HY-10448)-induced CGRP release and vasodilation. ω-Agatoxin IVA TFA can be used for the research of neurological and cardiovascular disease.
For research use only. We do not sell to patients.
- Purity : 99.52%
- Formula: C217H360N68O60S10.C2HF3O2
- Molecular Weight:5316.27
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications Citing Use of MedChemExpress (MCE) ω-Agatoxin IVA TFA
MoreAll Calcium Channel Isoforms
More
Biological Activity
Description
IC50 & Target
[1]|
P/Q-type calcium channel |
In Vitro
ω-Agatoxin IVA TFA potently inhibits somatic P-type calcium channels in rat cerebellar Purkinje neurons with an IC50 of 2 nM[1].
ω-Agatoxin IVA TFA inhibits Q-type calcium channels in rat cerebellar granule neurons with an IC50 of 90 nM, which is 45-fold less potent than its activity against P-type channels[1].
ω-Agatoxin IVA TFA inhibits high potassium-induced glutamate exocytosis and calcium influx in rat cortical synaptosomes with IC50 values ranging from 30 nM to 225 nM[1].
ω-Agatoxin IVA (200 nM) TFA inhibits cloned rat brain rbA-I and rbA-II calcium channel isoforms by only 20%[1].
ω-Agatoxin IVA (100 nM) TFA does not inhibit voltage-dependent calcium currents in cultured rat sympathetic neurons[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not alter frequency-dependent neurogenic excitatory responses in isolated rabbit pulmonary artery ring preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly inhibit neurogenic cholinergic excitatory responses in isolated guinea-pig myenteric plexus preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly inhibit neurogenic noradrenergic excitatory responses in isolated rat vas deferens preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly inhibit neurogenic excitatory responses in isolated rat bladder strip preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly inhibit neurogenic noradrenergic excitatory responses in isolated rat anococcygeus muscle preparations[2].
ω-Agatoxin IVA (100 nM; 30 min) TFA does not significantly alter neurogenic NANC inhibitory responses in isolated Atropine (HY-B1205)/Guanethidine (HY-B1251)-treated rat anococcygeus muscle and jejunum preparations preparations[2].
ω-Agatoxin IVA (0.1 μmol/L; 30 min) TFA potently inhibits Capsaicin (HY-10448)-induced CGRP release from isolated rat pial arteries[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague-Dawley with Capsaicin-induced vasodilation (male, 250 to 300 g, 12 to 14 weeks old)[3]
-
Dosage:0.1 μmol/L
-
Administration:topical suffusion; 30 minutes before and during exposure/induction
-
Result:Caused a marginal 14.6% increase in baseline pial arterial diameter.
Significantly inhibited capsaicin-induced pial arterial vasodilation.
Increased the slope of the regression line for the vasodilation phase from -1.71 (vehicle) to -0.27.
Increased the slope for the vasoconstriction phase from -1.55 (vehicle) to -0.42.
Chemical Information
-
Appearance Solid
-
Molecular Weight 5316.27
-
Formula C217H360N68O60S10.C2HF3O2
-
Color White to off-white
-
Sequence
Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala (Disulfide bridge:Cys4-Cys20,Cys12-Cys25,Cys19-Cys36,Cys27-Cys34)
-
Sequence Shortening
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Disulfide bridge:Cys4-Cys20,Cys12-Cys25,Cys19-Cys36,Cys27-Cys34)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (1)
-
Journal Impact Factor
-
Most Recent
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (18.81 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (279 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. T Teramoto, et al. A novel type of calcium channel sensitive to omega-agatoxin-TK in cultured rat cerebral cortical neurons. Brain Res. 1997 May 9;756(1-2):225-30. [Content Brief]
[2]. Lundy P M, Frew R. Effect of ω-agatoxin-IVA on autonomic neurotransmission[J]. European journal of pharmacology, 1994, 261(1-2): 79-84. [Content Brief]
[3]. Hong KW, et al. Effect of omega-conotoxin GVIA and omega-agatoxin IVA on the capsaicin-sensitive calcitonin gene-related peptide release and autoregulatory vasodilation in rat pial arteries. J Cereb Blood Flow Metab. 1999;19(1):53-60. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.1881 mL | 0.9405 mL | 1.8810 mL | 4.7025 mL |
| 5 mM | 0.0376 mL | 0.1881 mL | 0.3762 mL | 0.9405 mL | |
| 10 mM | 0.0188 mL | 0.0941 mL | 0.1881 mL | 0.4703 mL | |
| 15 mM | 0.0125 mL | 0.0627 mL | 0.1254 mL | 0.3135 mL |