PCSK9 Inhibitor, EGF-A
PCSK9 Inhibitor, EGF-A is a PCSK9 inhibitor with LDLR degradation inhibitory activity and LDLR recycling promoting activity. PCSK9 Inhibitor, EGF-A is a synthetic peptide consisting of 42 amino acid residues, which contains the calcium-binding site of the epidermal growth factor A domain (EGF-A). PCSK9 Inhibitor, EGF-A reduces plasma LDL cholesterol levels by maintaining hepatic LDLR levels and enhancing the clearance capacity of circulating LDL. PCSK9 Inhibitor, EGF-A can be used in research related to hypercholesterolemia, premature atherosclerosis, coronary heart disease and familial hypercholesterolemia.
For research use only. We do not sell to patients.
- Formula: C188H292N58O65S6
- Molecular Weight:4597.07
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
In Vitro
The binding of the PCSK9 inhibitor, EGF-A, to PCSK9 is pH- and calcium ion-dependent (Kd = 300 nM at 2 mM calcium ion concentration and pH 5.2; Kd = 1.0 nM at pH 7.4)[1].
PCSK9 Inhibitor, EGF-A blocks the interactions between PCSK9 and low-density lipoprotein receptor (IC50 = 3.4 μM), as well as very-low-density lipoprotein receptor (IC50 = 4.7 μM)[1].
PCSK9 Inhibitor, EGF-A (1.5-15) inhibits the degradation of mature low-density lipoprotein receptors in HepG2 cells in a dose-dependent manner[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 4597.07
-
Formula C188H292N58O65S6
-
Sequence
Gly-Thr-Asn-Glu-Cys-Leu-Asp-Asn-Asn-Gly-Gly-Cys-Ser-His-Val-Cys-Asn-Asp-Leu-Lys-Ile-Gly-Tyr-Glu-Cys-Leu-Cys-Pro-Asp-Gly-Phe-Gln-Leu-Val-Ala-Gln-Arg-Arg-Cys-Glu-Asp-Ile-NH2 (disulfide bridge: Cys5-Cys16, Cys12-Cys25, Cys27-Cys39)
-
Sequence Shortening
GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2 (disulfide bridge: Cys5-Cys16, Cys12-Cys25, Cys27-Cys39)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Zhang DW, Lagace TA, Garuti R, et al.. Binding of proprotein convertase subtilisin/kexin type 9 to epidermal growth factor-like repeat A of low density lipoprotein receptor decreases receptor recycling and increases degradation. The Journal of biological chemistry. 2007 Jun 22;282(25):18602-18612. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)