PCSK9 Inhibitor, EGF-A
PCSK9 Inhibitor, EGF-A is a PCSK9 inhibitor with LDLR degradation inhibitory activity and LDLR recycling promoting activity. PCSK9 Inhibitor, EGF-A is a synthetic peptide consisting of 42 amino acid residues, which contains the calcium-binding site of the epidermal growth factor A domain (EGF-A). PCSK9 Inhibitor, EGF-A reduces plasma LDL cholesterol levels by maintaining hepatic LDLR levels and enhancing the clearance capacity of circulating LDL. PCSK9 Inhibitor, EGF-A can be used in research related to hypercholesterolemia, premature atherosclerosis, coronary heart disease and familial hypercholesterolemia.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Formel: C188H292N58O65S6
- Molecular Weight:4597.07
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
Beschreibung
In Vitro
The binding of the PCSK9 inhibitor, EGF-A, to PCSK9 is pH- and calcium ion-dependent (Kd = 300 nM at 2 mM calcium ion concentration and pH 5.2; Kd = 1.0 nM at pH 7.4)[1].
PCSK9 Inhibitor, EGF-A blocks the interactions between PCSK9 and low-density lipoprotein receptor (IC50 = 3.4 μM), as well as very-low-density lipoprotein receptor (IC50 = 4.7 μM)[1].
PCSK9 Inhibitor, EGF-A (1.5-15) inhibits the degradation of mature low-density lipoprotein receptors in HepG2 cells in a dose-dependent manner[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
Chemical Information
-
Molecular Weight 4597.07
-
Formel C188H292N58O65S6
-
Sequence
Gly-Thr-Asn-Glu-Cys-Leu-Asp-Asn-Asn-Gly-Gly-Cys-Ser-His-Val-Cys-Asn-Asp-Leu-Lys-Ile-Gly-Tyr-Glu-Cys-Leu-Cys-Pro-Asp-Gly-Phe-Gln-Leu-Val-Ala-Gln-Arg-Arg-Cys-Glu-Asp-Ile-NH2 (disulfide bridge: Cys5-Cys16, Cys12-Cys25, Cys27-Cys39)
-
Sequence Shortening
GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2 (disulfide bridge: Cys5-Cys16, Cys12-Cys25, Cys27-Cys39)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Protokoll
-
Protocol for Pharmacokinetic Study
Pharmacokinetic studies quantify how an organism handles a drug over time through absorption, distribution, metabolism, and excretion, and the core experimental readout is the concentration-time profile of parent drug and, when relevant, metabolites in biological matrices such as plasma, whole blood, urine, bile, or tissue. Pharmacokinetic analysis links dose, route, exposure, clearance, half-life, distribution, bioavailability, and systemic exposure to drug efficacy and toxicity hypotheses rather than measuring a signaling pathway directly. The literature links pharmacokinetics to drug-development phenotypes by showing that drug metabolism and pharmacokinetics influence compound progression, exposure-response interpretation, safety margins, dosing strategy, and failure risk during discovery and development. DMPK science contributes to compound optimization by integrating physicochemical properties, in vitro metabolism, transporter behavior, in vivo exposure, and pharmacodynamic contex
-
Research Protocol for Cardiovascular Diseases
Cardiovascular disease can be modeled as maladaptive cardiac remodeling, where ischemic injury or pressure overload activates inflammatory signaling, fibroblast activation, extracellular-matrix deposition, cardiomyocyte hypertrophy, vascular remodeling, and progressive ventricular dysfunction. The TGF-β/SMAD axis is a central profibrotic pathway after myocardial injury and pressure overload, while innate immune and cytokine pathways regulate leukocyte recruitment, scar formation, and adverse remodeling. Key unresolved questions include which inflammatory signals are reparative versus harmful, when fibrosis is protective versus maladaptive, and whether pathway inhibition improves function without weakening necessary infarct healing or compensatory remodeling.
Reinheit & Dokumentation
Verweise
[1]. Zhang DW, Lagace TA, Garuti R, et al.. Binding of proprotein convertase subtilisin/kexin type 9 to epidermal growth factor-like repeat A of low density lipoprotein receptor decreases receptor recycling and increases degradation. The Journal of biological chemistry. 2007 Jun 22;282(25):18602-18612. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)