BMP-3 Protein, Human
Based on 1 Customer Validation
BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. BMP-3 Protein, Human is the recombinant human-derived BMP-3 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. BMP-3 Protein, Human is the recombinant human-derived BMP-3 protein, expressed by E. coli , with tag free.
Background
BMP-3 Protein, a member of the TGF-beta superfamily, plays a crucial role in developmental processes, particularly in inducing and patterning early skeletal formation, while concurrently acting as a negative regulator of bone density. Notably, it counteracts the osteogenic BMPs' ability to induce osteoprogenitor differentiation and ossification. The initiation of signaling cascades involves BMP-3 associating with the type II receptor ACVR2B, activating both SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK pathways. Structurally, BMP-3 exists as a homodimer linked by disulfide bonds and interacts with the type II receptor ACVR2B to exert its regulatory functions.
Verified Bioactivity
Measured by its ability to inhibit BMP-2-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. 30 µg/mL of hBMP-3 will antagonize hBMP-2 (0.25 µg/mL) induction of alkaline phosphatase in MC3T3E1 cells by 52.83%.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P12645 (Q363-R472)
-
Molecular Construction
-
N-term
-
BMP-3 (Q363-R472)
Accession # P12645 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
BMP3; Bone Morphogenetic Protein 3A; Bone Morphogenetic Protein 3; BMP-3A; Osteogenin; BMP-3; Bone Morphogenetic Protein 3 (Osteogenic); BMP3A
-
AA Sequence
QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
-
Predicted Molecular Mass
12.4 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)