Complement C5a Protein, Cynomolgus
Based on 1 Customer Validation
Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Cynomolgus is the recombinant cynomolgus-derived Complement C5/C5a protein, expressed by E. coli , with tag free.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Cynomolgus is the recombinant cynomolgus-derived Complement C5/C5a protein, expressed by E. coli , with tag free.
Upon activation by a C5 convertase, Complement C5 initiates the spontaneous assembly of the late complement components, C5-C9, forming the membrane attack complex. The transient binding site for C6 on C5b is crucial for the foundation of the lytic complex. The proteolytic degradation of complement C5 produces C5a anaphylatoxin, a mediator of local inflammatory processes. C5a interacts with its receptor C5AR1, triggering diverse responses such as intracellular calcium release, smooth muscle contraction, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. Acting as a potent chemokine, C5a stimulates the locomotion of polymorphonuclear leukocytes and guides their migration toward sites of inflammation, contributing to the orchestration of immune responses.
1.Immobilized Cynomolgus Complement C5a at 2 μg/mL (100 μL/well) can bind Anti-C5a (Human IgG1) with a linear range of 0.8-13 ng/mL.
2.Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a. The ED50 for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×104 units/mg.
-
Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a, The ED50 for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×104 units/mg.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag Tag Free
-
Accession
XP_015292262.1 (M678-R751)
-
Molecular Construction
-
N-term
-
C5a (M678-R751)
Accession # XP_015292262.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
C5a; Complement Component 5a
-
AA Sequence
MLQEKIEEIAAKYKHLVVKKCCYDGVRINHDETCEQRAARISVGPRCVKAFTECCVVASQLRANNSHKDLQLGR
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
