Complement C5/C5a Protein, Cynomolgus

Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5/C5a Protein, Cynomolgus is the recombinant cynomolgus-derived Complement C5/C5a protein, expressed by E. coli , with tag free. The total length of Complement C5/C5a Protein, Cynomolgus is 74 a.a., with molecular weight of ~11 kDa.

Upon activation by a C5 convertase, Complement C5 initiates the spontaneous assembly of the late complement components, C5-C9, forming the membrane attack complex. The transient binding site for C6 on C5b is crucial for the foundation of the lytic complex. The proteolytic degradation of complement C5 produces C5a anaphylatoxin, a mediator of local inflammatory processes. C5a interacts with its receptor C5AR1, triggering diverse responses such as intracellular calcium release, smooth muscle contraction, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. Acting as a potent chemokine, C5a stimulates the locomotion of polymorphonuclear leukocytes and guides their migration toward sites of inflammation, contributing to the orchestration of immune responses.

1.Immobilized Cynomolgus Complement C5a at 2 μg/mL (100 μL/well) can bind Anti-C5a (Human IgG1) with a linear range of 0.8-13 ng/mL.
2.Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a. The ED₅₀ for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×10⁴ units/mg.

• 
  Immobilized C5a at 2 μg/mL (100 μL/well) can bind anti-C5a,  The ED₅₀ for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×10⁴ units/mg.

Cynomolgus

E. coli

Tag Free

XP_015292262.1 (M678-R751)

/

MLQEKIEEIAAKYKHLVVKKCCYDGVRINHDETCEQRAARISVGPRCVKAFTECCVVASQLRANNSHKDLQLGR

Approximately 11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.