1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. COPS5 Protein, Human

The COPS5 protein is a possible protease subunit of the COP9 signalosome complex (CSN) and regulates the ubiquitin conjugation pathway by demethylating the cullin subunit of the SCF-type E3 ligase complex. This activity reduces Ubl ligase activity, affecting complexes such as SCF, CSA, or DDB2. COPS5 Protein, Human is the recombinant human-derived COPS5 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The COPS5 protein is a possible protease subunit of the COP9 signalosome complex (CSN) and regulates the ubiquitin conjugation pathway by demethylating the cullin subunit of the SCF-type E3 ligase complex. This activity reduces Ubl ligase activity, affecting complexes such as SCF, CSA, or DDB2. COPS5 Protein, Human is the recombinant human-derived COPS5 protein, expressed by E. coli , with tag free.

Background

The COPS5 protein serves as the probable protease subunit within the COP9 signalosome complex (CSN), a vital regulator involved in diverse cellular and developmental processes. Operating as a crucial component of the CSN complex, COPS5 plays a central role in the regulation of the ubiquitin conjugation pathway by facilitating the deneddylation of the cullin subunits within SCF-type E3 ligase complexes. This deneddylation activity results in the reduction of Ubl ligase activity, impacting complexes such as SCF, CSA, or DDB2. Moreover, the CSN complex, in association with CK2 and PKD kinases, is implicated in the phosphorylation of various substrates, including p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1, and IRF8. COPS5 likely functions as the catalytic center mediating the cleavage of Nedd8 from cullins within the complex, thereby influencing the regulatory landscape of protein degradation. Its direct interaction with numerous proteins regulated by the CSN complex underscores its key role in mediating cellular processes and highlights its involvement in the proteasomal degradation of BRSK2.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q92905 (A2-T257)

Gene ID

10987

Molecular Construction
N-term
COPS5 (A2-T257)
Accession # Q92905
C-term
Protein Length

Partial

Synonyms
COPS5; COP9 signalosome complex subunit 5; SGN5; Signalosome subunit 5; Jun activation domain-binding protein 1
AA Sequence

AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLT

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

COPS5 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

COPS5 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COPS5 Protein, Human
Cat. No.:
HY-P701437
Quantity:
MCE Japan Authorized Agent: