1. Recombinant Proteins
  2. Others
  3. EXOSC2 Protein, Human

EXOSC2 is a non-catalytic RNA exosome complex component that plays an important role in 3'->5' exoribonuclease activity and affects a variety of cellular RNA processing and degradation processes. In the nucleus, it helps stabilize the maturation of RNA species and eliminates processing by-products, non-coding transcripts and defective mRNAs. EXOSC2 Protein, Human is the recombinant human-derived EXOSC2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EXOSC2 is a non-catalytic RNA exosome complex component that plays an important role in 3'->5' exoribonuclease activity and affects a variety of cellular RNA processing and degradation processes. In the nucleus, it helps stabilize the maturation of RNA species and eliminates processing by-products, non-coding transcripts and defective mRNAs. EXOSC2 Protein, Human is the recombinant human-derived EXOSC2 protein, expressed by E. coli , with tag free.

Background

EXOSC2, a non-catalytic component of the RNA exosome complex, plays a crucial role in 3'->5' exoribonuclease activity, contributing to diverse cellular RNA processing and degradation events. Within the nucleus, the RNA exosome complex facilitates the proper maturation of stable RNA species, including rRNA, snRNA, and snoRNA, while eliminating RNA processing by-products, non-coding transcripts such as antisense RNA species, promoter-upstream transcripts (PROMPTs), and mRNAs with processing defects. This process limits their export to the cytoplasm. The RNA exosome is implicated in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM), directing AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, EXOSC2 contributes to general mRNA turnover and selectively degrades inherently unstable mRNAs with AU-rich elements (AREs) within their 3' untranslated regions, preventing the translation of aberrant mRNAs in RNA surveillance pathways. Additionally, it appears to be involved in the degradation of histone mRNA. As a component of the catalytically inactive RNA exosome core (Exo-9), EXOSC2 plays a crucial role in binding and presenting RNA for ribonucleolysis, serving as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC2, as a peripheral part of the Exo-9 complex, stabilizes the hexameric ring of RNase PH domain-containing subunits, forming contacts with EXOSC4 and EXOSC7. This multifaceted interaction underscores the versatile role of EXOSC2 in RNA-related processes.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q13868 (M1-G293)

Gene ID

23404

Molecular Construction
N-term
EXOSC2 (M1-G293)
Accession # Q13868
C-term
Protein Length

Full Length

Synonyms
EXOSC2; Exosome complex component RRP4; Exosome component 2; Ribosomal RNA-processing protein 4
AA Sequence

MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EXOSC2 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EXOSC2 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EXOSC2 Protein, Human
Cat. No.:
HY-P701607
Quantity:
MCE Japan Authorized Agent: