GNMT Protein, Human (His)
Based on 1 publication(s) in Google Scholar
Glycine N-methyltransferase (GNMT) is responsible for catalyzing the methylation of glycine, using S-adenosylmethionine (AdoMet) to generate N-methylglycine (sarcosine), and simultaneously producing S-adenosyl homocysteine AdoHcy. This reaction is complexly regulated by 5-methyltetrahydrofolate binding, highlighting the critical role of GNMT in the regulation of methyl metabolism. GNMT Protein, Human (His) is the recombinant human-derived GNMT protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Glycine N-methyltransferase (GNMT) is responsible for catalyzing the methylation of glycine, using S-adenosylmethionine (AdoMet) to generate N-methylglycine (sarcosine), and simultaneously producing S-adenosyl homocysteine AdoHcy. This reaction is complexly regulated by 5-methyltetrahydrofolate binding, highlighting the critical role of GNMT in the regulation of methyl metabolism. GNMT Protein, Human (His) is the recombinant human-derived GNMT protein, expressed by E. coli , with N-6*His labeled tag.
Background
Glycine N-methyltransferase (GNMT) is an enzyme that catalyzes the methylation of glycine using S-adenosylmethionine (AdoMet) as a methyl donor, resulting in the formation of N-methylglycine (sarcosine) and S-adenosylhomocysteine (AdoHcy). This reaction is crucial in the regulation of methyl group metabolism, as GNMT plays a key role in maintaining the balance between S-adenosyl-L-methionine and S-adenosyl-L-homocysteine levels. The enzyme is involved in the regulation of one-carbon metabolism and contributes to the control of the cellular methylation potential. The binding of 5-methyltetrahydrofolate is implicated in modulating the activity of GNMT, highlighting its role in coordinating methyl group utilization and homeostasis.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Biochem Biophys
Brucine Suppresses Malignant Progression of Prostate Cancer by Decreasing Sarcosine Accumulation via Downregulation of GNMT in the Glycine/sarcosine Metabolic Pathway. [Abstract]2024 Sep;82(3):2373-2385. PMID: 38877335
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q14749 (M1-D295)
-
Molecular Construction
-
N-term
-
6*His
-
GNMT (M1-D295)
Accession # Q14749 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GNMT; Epididymis Secretory Sperm Binding Protein Li 182mP; Glycine N-Methyltransferase; HEL-S-182mP
-
AA Sequence
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD
-
Predicted Molecular Mass
34.9 kDa
-
Molecular Weight
Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
1.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
2.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 6% trehalose, 0.02% Tween 20, pH 8.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)