Copy Link Print Information

GNMT Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Glycine N-methyltransferase (GNMT) is responsible for catalyzing the methylation of glycine, using S-adenosylmethionine (AdoMet) to generate N-methylglycine (sarcosine), and simultaneously producing S-adenosyl homocysteine AdoHcy. This reaction is complexly regulated by 5-methyltetrahydrofolate binding, highlighting the critical role of GNMT in the regulation of methyl metabolism. GNMT Protein, Human (His) is the recombinant human-derived GNMT protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • GNMT Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Glycine N-methyltransferase (GNMT) is responsible for catalyzing the methylation of glycine, using S-adenosylmethionine (AdoMet) to generate N-methylglycine (sarcosine), and simultaneously producing S-adenosyl homocysteine AdoHcy. This reaction is complexly regulated by 5-methyltetrahydrofolate binding, highlighting the critical role of GNMT in the regulation of methyl metabolism. GNMT Protein, Human (His) is the recombinant human-derived GNMT protein, expressed by E. coli , with N-6*His labeled tag.

Background

Glycine N-methyltransferase (GNMT) is an enzyme that catalyzes the methylation of glycine using S-adenosylmethionine (AdoMet) as a methyl donor, resulting in the formation of N-methylglycine (sarcosine) and S-adenosylhomocysteine (AdoHcy). This reaction is crucial in the regulation of methyl group metabolism, as GNMT plays a key role in maintaining the balance between S-adenosyl-L-methionine and S-adenosyl-L-homocysteine levels. The enzyme is involved in the regulation of one-carbon metabolism and contributes to the control of the cellular methylation potential. The binding of 5-methyltetrahydrofolate is implicated in modulating the activity of GNMT, highlighting its role in coordinating methyl group utilization and homeostasis.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    Q14749 (M1-D295)

  • Gene ID
    27232  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • GNMT (M1-D295)
      Accession # Q14749
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    GNMT; Epididymis Secretory Sperm Binding Protein Li 182mP; Glycine N-Methyltransferase; HEL-S-182mP

  • AA Sequence

    MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

  • Predicted Molecular Mass

    34.9 kDa

  • Molecular Weight

    Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
2.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 6% trehalose, 0.02% Tween 20, pH 8.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • GNMT Protein, Human (His) Product Image
    1/16
  • GNMT Protein, Human (His) Product Image