Ig Lambda Constant 2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The Ig Lambda Constant 2 protein is part of the constant region of the immunoglobulin light chain. It acts as a receptor during the recognition phase of humoral immunity, triggering B lymphocyte expansion and differentiation into plasma cells. Ig Lambda Constant 2 Protein, Human (HEK293, His) is the recombinant human-derived Ig Lambda Constant 2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The Ig Lambda Constant 2 protein is part of the constant region of the immunoglobulin light chain. It acts as a receptor during the recognition phase of humoral immunity, triggering B lymphocyte expansion and differentiation into plasma cells. Ig Lambda Constant 2 Protein, Human (HEK293, His) is the recombinant human-derived Ig Lambda Constant 2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The constant region of immunoglobulin light chains, specifically Ig Lambda Constant 2 protein, is integral to the structure of antibodies, also known as immunoglobulins. These membrane-bound or secreted glycoproteins are produced by B lymphocytes and function as receptors in the recognition phase of humoral immunity. Upon binding a specific antigen, membrane-bound immunoglobulins instigate the clonal expansion and differentiation of B lymphocytes into plasma cells that secrete immunoglobulins. Secreted immunoglobulins, in turn, play a pivotal role in the effector phase of humoral immunity, facilitating the elimination of bound antigens. The antigen binding site is orchestrated by the variable domain of one heavy chain, coupled with that of its associated light chain, resulting in each immunoglobulin possessing two antigen binding sites with remarkable affinity for a particular antigen. The variable domains undergo V-(D)-J rearrangement and subsequent somatic hypermutations, enabling affinity maturation after exposure to antigen and selection. Immunoglobulins are composed of two identical heavy chains and two identical light chains, interconnected by disulfide linkages.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P0DOY2 (G1-S106)
-
Molecular Construction
-
N-term
-
IGLC2 (G1-S106)
Accession # P0DOY2 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
IGLC2; Ig Lambda Chain C Region NIG-64; Prev. IGLC; Ig Lambda Chain C Region SH; Immunoglobulin Lambda Constant 2 (Kern-Oz- Marker); Ig Lambda-2 Chain C Region; Immunoglobulin Lambda Constant Region 2 (Kern- Oz- Marker); Ig Lambda Chain C Region X; Ig Lig
-
AA Sequence
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
-
Predicted Molecular Mass
12.1 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)