Ig Lambda Constant 2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The Ig Lambda Constant 2 protein is part of the constant region of the immunoglobulin light chain. It acts as a receptor during the recognition phase of humoral immunity, triggering B lymphocyte expansion and differentiation into plasma cells. Ig Lambda Constant 2 Protein, Human (HEK293, His) is the recombinant human-derived Ig Lambda Constant 2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Ig Lambda Constant 2 protein is part of the constant region of the immunoglobulin light chain. It acts as a receptor during the recognition phase of humoral immunity, triggering B lymphocyte expansion and differentiation into plasma cells. Ig Lambda Constant 2 Protein, Human (HEK293, His) is the recombinant human-derived Ig Lambda Constant 2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The constant region of immunoglobulin light chains, specifically Ig Lambda Constant 2 protein, is integral to the structure of antibodies, also known as immunoglobulins. These membrane-bound or secreted glycoproteins are produced by B lymphocytes and function as receptors in the recognition phase of humoral immunity. Upon binding a specific antigen, membrane-bound immunoglobulins instigate the clonal expansion and differentiation of B lymphocytes into plasma cells that secrete immunoglobulins. Secreted immunoglobulins, in turn, play a pivotal role in the effector phase of humoral immunity, facilitating the elimination of bound antigens. The antigen binding site is orchestrated by the variable domain of one heavy chain, coupled with that of its associated light chain, resulting in each immunoglobulin possessing two antigen binding sites with remarkable affinity for a particular antigen. The variable domains undergo V-(D)-J rearrangement and subsequent somatic hypermutations, enabling affinity maturation after exposure to antigen and selection. Immunoglobulins are composed of two identical heavy chains and two identical light chains, interconnected by disulfide linkages.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IGLC2 (G1-S106)
      Accession # P0DOY2
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    IGLC2; Ig Lambda Chain C Region NIG-64; Prev. IGLC; Ig Lambda Chain C Region SH; Immunoglobulin Lambda Constant 2 (Kern-Oz- Marker); Ig Lambda-2 Chain C Region; Immunoglobulin Lambda Constant Region 2 (Kern- Oz- Marker); Ig Lambda Chain C Region X; Ig Lig

  • AA Sequence

    GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

  • Predicted Molecular Mass

    12.1 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00