LAMTOR2 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

LAMTOR2 is a key component of the Ragulator complex, which centralizes amino acid sensing and mTORC1 activation in response to stimuli such as growth factors, energy levels, and amino acids. As an amino acid-activated guanine nucleotide exchange factor (GEF), the Ragulator complex recruits Rag GTPases (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD) to the lysosomal membrane. LAMTOR2 Protein, Human (His) is the recombinant human-derived LAMTOR2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LAMTOR2 is a key component of the Ragulator complex, which centralizes amino acid sensing and mTORC1 activation in response to stimuli such as growth factors, energy levels, and amino acids. As an amino acid-activated guanine nucleotide exchange factor (GEF), the Ragulator complex recruits Rag GTPases (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD) to the lysosomal membrane. LAMTOR2 Protein, Human (His) is the recombinant human-derived LAMTOR2 protein, expressed by E. coli , with N-His labeled tag.

Background

As a crucial component of the Ragulator complex, LAMTOR2 plays a central role in amino acid sensing and the activation of mTORC1, a signaling complex that promotes cell growth in response to various stimuli, including growth factors, energy levels, and amino acids. Activated by amino acids, the Ragulator complex functions as a guanine nucleotide exchange factor (GEF) for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD), simultaneously mediating the recruitment of Rag GTPases to the lysosome membrane. This orchestrated activation of the Ragulator and Rag GTPases serves as a scaffold, recruiting mTORC1 to lysosomes, where it is subsequently activated. Additionally, LAMTOR2 acts as an adapter protein enhancing the efficiency of the MAP kinase cascade, facilitating the activation of MAPK2 (By similarity). LAMTOR2 is part of the Ragulator complex, interacting with LAMTOR1 and LAMTOR3, and is a key player in the lysosomal folliculin complex (LFC), which includes FLCN, FNIP1 (or FNIP2), RagA/RRAGA or RagB/RRAGB GDP-bound, RagC/RRAGC or RagD/RRAGD GTP-bound, and Ragulator.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • LAMTOR2 (M1-S125)
      Accession # Q9Y2Q5-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    LAMTOR2; Ragulator Complex Protein LAMTOR2; Prev. ROBLD3; Endosomal Adaptor Protein P14; MAPBPIP; MAPBP-Interacting Protein; Ragulator2; MAPKSP1 Adaptor Protein; MAPKSP1AP; Mitogen-Activated Protein-Binding Protein-Interacting Protein (MAPBPIP); ENDAP; Mi

  • AA Sequence

    MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00