1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. RBCK1 Protein, Human

RBCK1 is an E3 ubiquitin protein ligase that cooperates with specific E2 enzymes such as UBE2L3/UBCM4 to transfer ubiquitin to substrates. It acts as an E3 ligase that oxidizes IREB2, relying on heme and oxygen for IREB2 ubiquitination. RBCK1 Protein, Human is the recombinant human-derived RBCK1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE RBCK1 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RBCK1 is an E3 ubiquitin protein ligase that cooperates with specific E2 enzymes such as UBE2L3/UBCM4 to transfer ubiquitin to substrates. It acts as an E3 ligase that oxidizes IREB2, relying on heme and oxygen for IREB2 ubiquitination. RBCK1 Protein, Human is the recombinant human-derived RBCK1 protein, expressed by E. coli , with tag free.

Background

RBCK1 Protein functions as an E3 ubiquitin-protein ligase, receiving ubiquitin from specific E2 enzymes, including UBE2L3/UBCM4, and transferring it to substrates. It acts as an E3 ligase for oxidized IREB2, requiring heme and oxygen for IREB2 ubiquitination. RBCK1 promotes the ubiquitination and proteasomal degradation of TAB2 and IRF3. As part of the LUBAC complex, RBCK1 catalyzes the conjugation of linear polyubiquitin chains to substrates, crucial for NF-kappa-B activation and inflammation regulation. The LUBAC complex is recruited to TNF-R1 signaling complex components, contributing to complex stability and preventing TNF-induced cell death. RBCK1, in conjunction with OTULIN, regulates canonical Wnt signaling during angiogenesis and binds polyubiquitin of various linkage types. Additionally, the LUBAC complex plays a role in innate immunity by forming a ubiquitin coat around bacteria invading the cytosol, acting as an 'eat-me' signal for xenophagy and promoting NF-kappa-B activation.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9BYM8 (D2-H510)

Gene ID

/

Molecular Construction
N-term
RBCK1 (D2-H510)
Accession # Q9BYM8
C-term
Protein Length

Partial

Synonyms
RBCK1; RanBP-type and C3HC4-type zinc finger-containing protein 1; HBV-associated factor 4; Heme-oxidized IRP2 ubiquitin ligase 1; HOIL-1; Hepatitis B virus X-associated protein 4; RING finger protein 54; RING-type E3 ubiquitin transferase HOIL-1; Ubiquitin-conjugating enzyme 7-interacting protein 3
AA Sequence

DEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH

Predicted Molecular Mass
57.6 kDa
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RBCK1 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RBCK1 Protein, Human
Cat. No.:
HY-P702076
Quantity:
MCE Japan Authorized Agent: