RBCK1 Protein, Human
Based on 1 publication(s) in Google Scholar
RBCK1 is an E3 ubiquitin protein ligase that cooperates with specific E2 enzymes such as UBE2L3/UBCM4 to transfer ubiquitin to substrates. It acts as an E3 ligase that oxidizes IREB2, relying on heme and oxygen for IREB2 ubiquitination. RBCK1 Protein, Human is the recombinant human-derived RBCK1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
RBCK1 is an E3 ubiquitin protein ligase that cooperates with specific E2 enzymes such as UBE2L3/UBCM4 to transfer ubiquitin to substrates. It acts as an E3 ligase that oxidizes IREB2, relying on heme and oxygen for IREB2 ubiquitination. RBCK1 Protein, Human is the recombinant human-derived RBCK1 protein, expressed by E. coli , with tag free.
RBCK1 Protein functions as an E3 ubiquitin-protein ligase, receiving ubiquitin from specific E2 enzymes, including UBE2L3/UBCM4, and transferring it to substrates. It acts as an E3 ligase for oxidized IREB2, requiring heme and oxygen for IREB2 ubiquitination. RBCK1 promotes the ubiquitination and proteasomal degradation of TAB2 and IRF3. As part of the LUBAC complex, RBCK1 catalyzes the conjugation of linear polyubiquitin chains to substrates, crucial for NF-kappa-B activation and inflammation regulation. The LUBAC complex is recruited to TNF-R1 signaling complex components, contributing to complex stability and preventing TNF-induced cell death. RBCK1, in conjunction with OTULIN, regulates canonical Wnt signaling during angiogenesis and binds polyubiquitin of various linkage types. Additionally, the LUBAC complex plays a role in innate immunity by forming a ubiquitin coat around bacteria invading the cytosol, acting as an 'eat-me' signal for xenophagy and promoting NF-kappa-B activation.
The ubiquitin conjugating activity of RBCK1 was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1, the E2 conjugating enzyme Ubch5b and Bodipy-ubiquitin. Incubation of RBCK1 for 60 minutes at 37˚C in the presence of Bodipy-ubiquitin, UBE1, Ubch5b and ATP was compared alongside two control reactions with either RBCK1 or RBCK1&ATP excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and RBCK1.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Rep
Pathogenic phosphorylation of linear ubiquitin machinery causes inflammasome sensor degradation. [Abstract]2025 Sep 12;44(9):116286. PMID: 40944911
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9BYM8 (D2-H510)
-
Gene ID/
-
Molecular Construction
-
N-term
-
RBCK1 (D2-H510)
Accession # Q9BYM8 -
C-term
-
-
Protein Length
Partial
-
Synonyms
RBCK1; Hepatitis B Virus X-Associated Protein 4; Prev. C20orf18; RING Finger Protein 54; UBCE7IP3; HOIL-1; RNF54; XAP3; XAP4; CDNA FLJ60704, Highly Similar To RanBP-Type And C3HC4-Type Zincfinger-Containing Protein 1; RanBP-Type And C3HC4-Type Zinc Finger
-
AA Sequence
DEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
-
Predicted Molecular Mass
57.6 kDa
-
Molecular Weight
Approximately 57 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 1 mM DTT, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
