1. Recombinant Proteins
  2. Others
  3. SNCA Protein, Human (His)

Alpha-synuclein (SNCA) is a key neuronal protein that regulates synaptic activity, including vesicle transport and neurotransmitter release. As a monomer, it enhances vesicle exocytosis, promotes fusion and fusion pore expansion, and increases local Ca(2+) release. SNCA Protein, Human (His) is the recombinant human-derived SNCA protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE SNCA Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Alpha-synuclein (SNCA) is a key neuronal protein that regulates synaptic activity, including vesicle transport and neurotransmitter release. As a monomer, it enhances vesicle exocytosis, promotes fusion and fusion pore expansion, and increases local Ca(2+) release. SNCA Protein, Human (His) is the recombinant human-derived SNCA protein, expressed by E. coli , with N-6*His labeled tag.

Background

alpha-Synuclein (SNCA), a pivotal neuronal protein, orchestrates diverse roles in synaptic activity, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it actively participates in synaptic vesicle exocytosis, enhancing vesicle priming, fusion, and dilation of exocytotic fusion pores, and mechanistically increases local Ca(2+) release from microdomains, crucial for ATP-induced exocytosis. In its multimeric membrane-bound state, SNCA functions as a molecular chaperone, assisting in the folding of synaptic fusion components (SNAREs) at the presynaptic plasma membrane, a process vital for maintaining normal SNARE-complex assembly during aging. SNCA also plays a crucial role in regulating dopamine neurotransmission by interacting with the dopamine transporter (DAT1) and modulating its activity. Existing as both a soluble monomer and homotetramer, a dynamic intracellular population of tetramers and monomers coexists, with the tetramer playing an essential role in maintaining homeostasis. SNCA engages in a complex network of interactions with proteins such as UCHL1, synphilin-1/SNCAIP, CALM1, STXBP1, VAMP2, SNAP25, RPH3A, RAB3A, SERF1A, and SEPTIN4, highlighting its involvement in intricate molecular processes governing synaptic function and integrity.

Biological Activity

Immobilized SNCA at 1 μg/mL (100 μL/well) can bind SNCA Antibody , The ED50 for this effect is 6.552-7.551 ng/mL.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P37840-1 (M1-A140)

Gene ID
Molecular Construction
N-term
6*His
SNCA (M1-A140)
Accession # P37840
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Alpha-Synuclein; Non-A Beta Component of AD Amyloid; Non-A4 Component of Amyloid Precursor; NACP; SNCA; NACP; PARK1
AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Predicted Molecular Mass
16.7 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SNCA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SNCA Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SNCA Protein, Human (His)
Cat. No.:
HY-P71327
Quantity:
MCE Japan Authorized Agent: