SPIN4 Protein, Human (His)

The SPIN4 protein exhibits H3K4me3 binding activity, demonstrating affinity for lysine 4 trimethylated histone H3. This unique combination suggests a role in recognizing specific chromatin modifications, potentially regulating gene expression or chromatin dynamics. SPIN4 Protein, Human (His) is the recombinant human-derived SPIN4 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SPIN4 protein exhibits H3K4me3 binding activity, demonstrating affinity for lysine 4 trimethylated histone H3. This unique combination suggests a role in recognizing specific chromatin modifications, potentially regulating gene expression or chromatin dynamics. SPIN4 Protein, Human (His) is the recombinant human-derived SPIN4 protein, expressed by E. coli , with N-6*His labeled tag.

Background

SPIN4 protein showcases H3K4me3-binding activity, indicating its affinity for histone H3 trimethylated at lysine 4. This unique binding ability suggests a potential role for SPIN4 in recognizing specific chromatin modifications, implicating it in the regulation of gene expression or chromatin dynamics. Additionally, SPIN4 interacts with C11orf84/SPINDOC, indicating a potential partnership or functional association with this interacting protein. These molecular interactions underscore the intricate involvement of SPIN4 in epigenetic processes and protein-protein interactions, hinting at its potential significance in cellular regulation and chromatin-related functions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • SPIN4 (S2-P249)
      Accession # Q56A73
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SPIN4; Spindlin-4

  • AA Sequence

    SPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00