SPR Protein, Human
SPR proteins play a key role in tetrahydrobiopterin biosynthesis by catalyzing the final one or two reductions required to form 5,6,7,8-tetrahydrobiopterin. This enzyme activity is critical for the production of tetrahydrobiopterin, a cofactor involved in various biochemical pathways, including neurotransmitter synthesis and nitric oxide production. SPR Protein, Human is the recombinant human-derived SPR protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
Biological Activity
SPR proteins play a key role in tetrahydrobiopterin biosynthesis by catalyzing the final one or two reductions required to form 5,6,7,8-tetrahydrobiopterin. This enzyme activity is critical for the production of tetrahydrobiopterin, a cofactor involved in various biochemical pathways, including neurotransmitter synthesis and nitric oxide production. SPR Protein, Human is the recombinant human-derived SPR protein, expressed by E. coli , with tag free.
Sapropterin reductase (SPR) is an enzyme that plays a crucial role in the biosynthesis of tetrahydrobiopterin (BH4). Specifically, SPR catalyzes the final one or two reductions in the tetrahydrobiopterin biosynthetic pathway, ultimately forming 5,6,7,8-tetrahydrobiopterin. This co-factor is essential for the activity of aromatic amino acid hydroxylases, which are involved in the synthesis of neurotransmitters and other bioactive molecules. The catalytic activity of SPR is vital for maintaining appropriate levels of tetrahydrobiopterin, which, in turn, influences the proper functioning of various physiological processes, including neurotransmitter production. Dysregulation of BH4 biosynthesis can impact neurotransmitter homeostasis and has been implicated in certain neurological disorders. It has to succinctly outline SPR's role in the final steps of tetrahydrobiopterin biosynthesis, underscoring its importance in supporting crucial biochemical pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P35270 (M1-K261)
-
Gene ID6697
-
Molecular Construction
-
N-term
-
SPR (M1-K261)
Accession # P35270 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SPR; Sepiapterin Reductase (7,8-Dihydrobiopterin:NADP+ Oxidoreductase); Sepiapterin Reductase; Sepiapterin Reductase (L-Erythro-7,8-Dihydrobiopterin Forming); SDR38C1; Short Chain Dehydrogenase/Reductase Family 38C, Member 1
-
AA Sequence
MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)