1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. SPR Protein, Human

SPR proteins play a key role in tetrahydrobiopterin biosynthesis by catalyzing the final one or two reductions required to form 5,6,7,8-tetrahydrobiopterin. This enzyme activity is critical for the production of tetrahydrobiopterin, a cofactor involved in various biochemical pathways, including neurotransmitter synthesis and nitric oxide production. SPR Protein, Human is the recombinant human-derived SPR protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 weeks 1 - 2 Weeks 3 - 4 weeks 2 - 3 weeks
50 μg Get quote 2 - 3 weeks 1 - 2 Weeks 3 - 4 weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPR proteins play a key role in tetrahydrobiopterin biosynthesis by catalyzing the final one or two reductions required to form 5,6,7,8-tetrahydrobiopterin. This enzyme activity is critical for the production of tetrahydrobiopterin, a cofactor involved in various biochemical pathways, including neurotransmitter synthesis and nitric oxide production. SPR Protein, Human is the recombinant human-derived SPR protein, expressed by E. coli , with tag free.

Background

Sapropterin reductase (SPR) is an enzyme that plays a crucial role in the biosynthesis of tetrahydrobiopterin (BH4). Specifically, SPR catalyzes the final one or two reductions in the tetrahydrobiopterin biosynthetic pathway, ultimately forming 5,6,7,8-tetrahydrobiopterin. This co-factor is essential for the activity of aromatic amino acid hydroxylases, which are involved in the synthesis of neurotransmitters and other bioactive molecules. The catalytic activity of SPR is vital for maintaining appropriate levels of tetrahydrobiopterin, which, in turn, influences the proper functioning of various physiological processes, including neurotransmitter production. Dysregulation of BH4 biosynthesis can impact neurotransmitter homeostasis and has been implicated in certain neurological disorders. It has to succinctly outline SPR's role in the final steps of tetrahydrobiopterin biosynthesis, underscoring its importance in supporting crucial biochemical pathways.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P35270 (M1-K261)

Gene ID

6697

Molecular Construction
N-term
SPR (M1-K261)
Accession # P35270
C-term
Protein Length

Full Length

Synonyms
SPR; Sepiapterin reductase; SPR
AA Sequence

MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SPR Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SPR Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPR Protein, Human
Cat. No.:
HY-P701862
Quantity:
MCE Japan Authorized Agent: