TSLP Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TSLP Protein, Human is an epithelial cell-derived cytokine which plays key role in allergic inflammation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

TSLP Protein, Human is an epithelial cell-derived cytokine which plays key role in allergic inflammation.

Background

Thymic stromal lymphopoietin (TSLP) is an epithelial cell derived cytokine expressed in skin, gut, lungs and thymus. TSLP signals via TSLPR, a heterodimer of the IL-7 receptor alpha chain (IL-7Rα) and the TSLP receptor chain (TSLPR). Thymic stromal lymphopoietin exerts profound influence on the polarization of dendritic cells (DCs) to drive T helper (Th) 2 cytokine production. It also directly promotes T cell proliferation in response to T cell receptor (TCR) activation, and Th2 cytokine production. Thymic stromal lymphopoietin also supports B cell expansion and differentiation. Thymic stromal lymphopoietin further amplifies Th2 cytokine production by mast cells and NKT cells[1]. Multiple innate immune cells express the TSLPR and respond to TSLP. For example, Thymic stromal lymphopoietin can enhance cytokine production from mast cells, NKT cells and eosinophils. In addition, Thymic stromal lymphopoietin has very recently been shown to induce eosinophil extracellular traps (EETs), extrusions of mitochondrial DNA toxic granule molecules released in response to infection[2].

Verified Bioactivity

1.The ED50 is <0.3 ng/mL as measured by murine BaF3 pro-B cells, corresponding to a specific activity of >3.3 × 106 units/mg.
2.Immobilized Human TSLP at 10 μg/mL (100 μl/well) can bind Human TSLP R-Fc .The ED50 of Human TSLP R-Fc is <0.35 μg/mL.
3. Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 5 μg/mL (100μl/well) on the plate can bind Human TSLPR. The ED50 for this effect is 18.65 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 5 μg/mL (100μl/well) on the plate can bind Human TSLPR. The ED50 for this effect is 18.65 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TSLP (Y29-Q159)
      Accession # Q969D9-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    Thymic Stroma-Derived Lymphopoietin; Thymic Stromal Lymphopoietin; TSLP

  • AA Sequence

    YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

  • Predicted Molecular Mass

    15.1 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, pH 7.4, 150 mM NaCl.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00