TSLP Protein, Human

TSLP Protein, Human is an epithelial cell-derived cytokine which plays key role in allergic inflammation.

Thymic stromal lymphopoietin (TSLP) is an epithelial cell derived cytokine expressed in skin, gut, lungs and thymus. TSLP signals via TSLPR, a heterodimer of the IL-7 receptor alpha chain (IL-7Rα) and the TSLP receptor chain (TSLPR). Thymic stromal lymphopoietin exerts profound influence on the polarization of dendritic cells (DCs) to drive T helper (Th) 2 cytokine production. It also directly promotes T cell proliferation in response to T cell receptor (TCR) activation, and Th2 cytokine production. Thymic stromal lymphopoietin also supports B cell expansion and differentiation. Thymic stromal lymphopoietin further amplifies Th2 cytokine production by mast cells and NKT cells^[1]. Multiple innate immune cells express the TSLPR and respond to TSLP. For example, Thymic stromal lymphopoietin can enhance cytokine production from mast cells, NKT cells and eosinophils. In addition, Thymic stromal lymphopoietin has very recently been shown to induce eosinophil extracellular traps (EETs), extrusions of mitochondrial DNA toxic granule molecules released in response to infection^[2].

1.The ED₅₀ is <0.3 ng/mL as measured by murine BaF3 pro-B cells, corresponding to a specific activity of >3.3 × 10⁶ units/mg.
2.Immobilized Human TSLP at 10 μg/mL (100 μl/well) can bind Human TSLP R-Fc .The ED₅₀ of Human TSLP R-Fc is 0.21 μg/mL.

Human

E. coli

Tag Free

Q969D9 (Y29-Q159)

85480  [NCBI]

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Approximately 15.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. He R, et al. Thymic stromal lymphopoietin. Ann N Y Acad Sci. 2010 Jan;1183:13-24.  [Content Brief]

  [2]. Ziegler SF, et al. The biology of thymic stromal lymphopoietin (TSLP). Adv Pharmacol. 2013;66:129-55.  [Content Brief]

  [3]. Liu YJ, et al. Thymic stromal lymphopoietin: master switch for allergic inflammation. J Exp Med. 2006 Feb 20;203(2):269-73.  [Content Brief]