1. Recombinant Proteins
  2. TSLP Protein, Human

TSLP Protein, Human

Cat. No.: HY-P7057
Handling Instructions

TSLP Protein, Human is an epithelial cell-derived cytokine which plays key role in allergic inflammation.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $640 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuTSLP; TSLP
Species

Human

Source

E. coli

Accession

Q969D9 (Y29-Q159)

Gene ID

85480

Molecular Weight

Approximately 15.1 kDa

AA Sequence

MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Biological Activity
The ED50 is <0.3 ng/mL as measured by murine BaF3 pro-B cells, corresponding to a specific activity of >3.3 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Thymic stromal lymphopoietin (TSLP) is an epithelial cell derived cytokine expressed in skin, gut, lungs and thymus. TSLP signals via TSLPR, a heterodimer of the IL-7 receptor alpha chain (IL-7Rα) and the TSLP receptor chain (TSLPR). Thymic stromal lymphopoietin exerts profound influence on the polarization of dendritic cells (DCs) to drive T helper (Th) 2 cytokine production. It also directly promotes T cell proliferation in response to T cell receptor (TCR) activation, and Th2 cytokine production. Thymic stromal lymphopoietin also supports B cell expansion and differentiation. Thymic stromal lymphopoietin further amplifies Th2 cytokine production by mast cells and NKT cells[1]. Multiple innate immune cells express the TSLPR and respond to TSLP. For example, Thymic stromal lymphopoietin can enhance cytokine production from mast cells, NKT cells and eosinophils. In addition, Thymic stromal lymphopoietin has very recently been shown to induce eosinophil extracellular traps (EETs), extrusions of mitochondrial DNA toxic granule molecules released in response to infection[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TSLP Protein, Human
Cat. No.:
HY-P7057
Quantity:
MCE Japan Authorized Agent: