1. Membrane Transporter/Ion Channel
    Neuronal Signaling
  2. nAChR
  3. α-Bungarotoxin

α-Bungarotoxin 

Cat. No.: HY-P1264
Handling Instructions

α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

α-Bungarotoxin Chemical Structure

α-Bungarotoxin Chemical Structure

CAS No. : 11032-79-4

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM[1][2].

In Vitro

α-Bungarotoxin binds specifically and with high affinity to the nicotinic acetylcholine receptor and competes with binding of the natural ligand. α-Bungarotoxin (α-BTX), is a potent competitive inhibitors of nicotinic acetylcholine receptor function and is highly toxic due to functional blockade of AcChoRs at the neuromuscular junction[3].

Molecular Weight

7984.12

Formula

C₃₃₈H₅₂₉N₉₇O₁₀₅S₁₁

CAS No.

11032-79-4

Sequence Shortening

IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge:Cys3-Cys33;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

α-BungarotoxinnAChRNicotinic acetylcholine receptorsligandionchannelsneurotoxinInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
α-Bungarotoxin
Cat. No.:
HY-P1264
Quantity:
MCE Japan Authorized Agent: