α-Bungarotoxin
Based on 9 publication(s) in Google Scholar
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM.
For research use only. We do not sell to patients.
- Purity: 99.11%
- CAS No.: 11032-79-4
- Formula: C338H529N97O105S11
- Molecular Weight:7984.12
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) α-Bungarotoxin
More- Redox Biol. 2023 Feb:59:102594. [Abstract]
- Mater Today Bio. 2025 Apr 10:32:101755. [Abstract]
- Cell Death Discov. 2026 Jun 23. [Abstract]
- Int Immunopharmacol. 2026 Aug 15:183:116879. [Abstract]
- Chem Biol Interact. 2024 Sep 1:400:111183. [Abstract]
- Neuromodulation. 2022 Dec;25(8):1122-1133. [Abstract]
- Neuropsychiatr Dis Treat. 2021 Aug 10;17:2599-2611. [Abstract]
- IBRO Neurosci Rep. 2024 Oct 24:17:389-397. [Abstract]
- Nicotine Tob Res. 2025 Jul 22;27(8):1420-1429. [Abstract]
-
Cell Proliferation/Viability Assay
-
WB
-
Apoptosis Analysis
-
IF
-
Bio/Physico-chemical Assay
Biological Activity
α-Bungarotoxin binds specifically and with high affinity to the nicotinic acetylcholine receptor and competes with binding of the natural ligand. α-Bungarotoxin (α-BTX), is a potent competitive inhibitors of nicotinic acetylcholine receptor function and is highly toxic due to functional blockade of AcChoRs at the neuromuscular junction[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 11032-79-4
-
Appearance Solid
-
Molecular Weight 7984.12
-
Formula C338H529N97O105S11
-
Color White to off-white
-
Sequence
Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys-Cys-Asn-Pro-His-Pro-Lys-Gln-Arg-Pro-Gly (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65)
-
Sequence Shortening
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (9)
-
Journal Impact Factor
-
Most Recent
-
Redox Biol
Diminished α7 nicotinic acetylcholine receptor (α7nAChR) rescues amyloid-β induced atrial remodeling by oxi-CaMKII/MAPK/AP-1 axis-mediated mitochondrial oxidative stress. [Abstract]2023 Feb:59:102594. PMID: 36603528
α-Bungarotoxin purchased from MedChemExpress. Usage Cited in: Redox Biol. 2023 Feb:59:102594. [Abstract]
α-BTX (0, 5, 20 and 50 nM) followed by Aβ (50 μM) for 72h. CCK-8 assays were performed to measure cell viability.
α-Bungarotoxin purchased from MedChemExpress. Usage Cited in: Redox Biol. 2023 Feb:59:102594. [Abstract]
α7nAChR protein level in HL-1 cells treated by 50 μM Aβ and/or 50 nM α-BTX.
α-Bungarotoxin purchased from MedChemExpress. Usage Cited in: Redox Biol. 2023 Feb:59:102594. [Abstract]
Apoptosis was evaluated by flow cytometry using PE Annexin-V/7-AAD staining treated with α-BTX (50 nM).
α-Bungarotoxin purchased from MedChemExpress. Usage Cited in: Redox Biol. 2023 Feb:59:102594. [Abstract]
Representative images analysis showing the levels of reactive oxygen species (ROS) of each group as measured by DHE staining (red) treated with α-BTX (50 nM).
α-Bungarotoxin purchased from MedChemExpress. Usage Cited in: Redox Biol. 2023 Feb:59:102594. [Abstract]
Quantifications of glutathione (GSH)/glutathione disulfide (GSSG) ratio treated with α-BTX (50 nM).
-
Mater Today Bio
Conductive MeCbl/PEDOT:PSS/HA hydrogels with electrical stimulation for enhanced peripheral nerve regeneration. [Abstract]2025 Apr 10:32:101755. PMID: 40290882 -
Cell Death Discov
AMPK/ SIRT1 signaling pathway activation acts on PGC-1α/ PPARγ to alleviate sepsis-acquired weakness. [Abstract]2026 Jun 23. PMID: 42337228 -
Int Immunopharmacol
Electroacupuncture protects intestinal barrier integrity in MAFLD mice and is associated with a macrophage α7nAChR/exosomal miR-217-5p/epithelial HO-1 signaling axis. [Abstract]2026 Aug 15:183:116879. PMID: 42161050 -
Chem Biol Interact
α7-nAChR/P300/NLRP3-regulated pyroptosis mediated poor articular cartilage quality induced by prenatal nicotine exposure in female offspring rats. [Abstract]2024 Sep 1:400:111183. PMID: 39098741 -
Neuromodulation
Electroacupuncture Ameliorates Intestinal Barrier Destruction in Mice With Bile Duct Ligation-Induced Liver Injury by Activating the Cholinergic Anti-Inflammatory Pathway. [Abstract]2022 Dec;25(8):1122-1133. PMID: 35300921 -
Neuropsychiatr Dis Treat
Electroacupuncture Pretreatment Ameliorates Anesthesia and Surgery-Induced Cognitive Dysfunction via Activation of an α7-nAChR Signal in Aged Rats. [Abstract]2021 Aug 10;17:2599-2611. PMID: 34413646 -
IBRO Neurosci Rep
Electroacupuncture alleviates paradoxical sleep deprivation-induced postoperative hyperalgesia via a7nAChR mediated BDNF/TrkB-KCC2 signaling pathway in the spinal cord. [Abstract]2024 Oct 24:17:389-397. PMID: 39559484 -
Nicotine Tob Res
The protective effect of low-dose nicotine on ischemia stroke by maintaining the integrity of the blood-brain barrier. [Abstract]2025 Jul 22;27(8):1420-1429. PMID: 39921606
Solvent & Solubility
H2O : ≥ 50 mg/mL (6.26 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (319 KB)
-
SDS (393 KB)
- English - EN (393 KB)
- Français - FR (393 KB)
- Deutsch - DE (393 KB)
- Norwegian - NO (393 KB)
- Español - ES (393 KB)
- Swedish - SV (393 KB)
- Italian - IT (393 KB)
- Korean - KR (393 KB)
- Portuguese - PT (393 KB)
-
Handling Instructions (2659 KB)
References
[1]. Hannan S, et al. Snake neurotoxin α-bungarotoxin is an antagonist at native GABA(A) receptors. Neuropharmacology. 2015;93:28-40. [Content Brief]
[2]. López MG, et al. Unmasking the functions of the chromaffin cell alpha7 nicotinic receptor by using short pulses of acetylcholine and selective blockers. Proc Natl Acad Sci U S A. 1998;95(24):14184-14189. [Content Brief]
[3]. Balass M, et al. The alpha-bungarotoxin binding site on the nicotinic acetylcholine receptor: analysis using a phage-epitope library. Proc Natl Acad Sci U S A. 1997;94(12):6054-6058. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.1252 mL | 0.6262 mL | 1.2525 mL | 3.1312 mL |
| 5 mM | 0.0250 mL | 0.1252 mL | 0.2505 mL | 0.6262 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.