α-Bungarotoxin, FITC labeled
Based on 1 Customer Validation
FITC-labeled α-Bungarotoxin is FITC-conjugated α-Bungarotoxin (HY-P1264). α-Bungarotoxin acts as a competitive antagonist of nicotinic acetylcholine receptors (nAChRs).
For research use only. We do not sell to patients.
- Molecular Weight:8500 (approximately)
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
In Vitro
Fluorescein-labeled α-bungarotoxin (20 μg/mL; 1 h) specifically labels a pair of neurons with a diameter of approximately 30 μm in the cerebral ganglion of Clione limacina, and its binding is completely blocked by 1 nM unlabeled α-bungarotoxin[2].
The binding of fluorescein-labeled α-bungarotoxin (20 μg/mL; 1 h) to neurons of the cerebral ganglion of Clione limacina is blocked by nicotinic acetylcholine receptor agonists and antagonists[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 8500 (approximately)
-
Color Yellow to orange
-
Sequence
Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys-Cys-Asn-Pro-His-Pro-Lys-Gln-Arg-Pro-Gly (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65),FITC labeled
-
Sequence Shortening
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65),FITC labeled
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Hannan S, et al. Snake neurotoxin α-bungarotoxin is an antagonist at native GABA(A) receptors. Neuropharmacology. 2015;93:28-40. [Content Brief]
[2]. Popova LB, et al. Staining of central neurons of the pteropod mollusk Clione limacina with fluorescein-labeled alpha-bungarotoxin. Neurosci Behav Physiol. 1999;29(3):317-320. [Content Brief]
[3]. Marques MJ, et al. Acetylcholine receptor organization at the dystrophic extraocular muscle neuromuscular junction. Anat Rec (Hoboken). 2007;290(7):846-854. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)