BNP-45 rat (Synonyms: Brain natriuretic peptide-45 rat)

Cat. No.: HY-P1573
Handling Instructions

BNP-45 (rat), a 45-amino acid brain natriurctic peptide isolated from rat heart, is a circulating hormone, with natriuretic and hypotensive activities. Sequence: Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge: Cys23-Cys39);SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfide bridge: Cys23-Cys39).

For research use only. We do not sell to patients.

BNP-45 rat Chemical Structure

BNP-45 rat Chemical Structure

CAS No. : 123337-89-3

Size Price Stock
500 μg USD 350 Get quote
1 mg USD 550 Get quote
5 mg USD 1500 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

Description

BNP-45 (rat), a 45-amino acid brain natriurctic peptide isolated from rat heart, is a circulating hormone, with natriuretic and hypotensive activities. Sequence: Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge: Cys23-Cys39);SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfide bridge: Cys23-Cys39).

In Vitro

BNP-45 (rat), a 45-amino acid brain natriurctic peptide isolated from rat heart, is a circulating hormone, with natriuretic and hypotensive activities[1].

In Vivo

BNP-45 (rat) (0.1, O.2, 0.5, 1.0 and 2.0 nmol/kg, i.v.) shows potent natriuretic and hypotensive activities in anesthetized spontaneously hypertensive rats (SHR) and Wistar-Kyoto rats (WKY). BNP-45 (rat) with high concentration decreases blood pressure in SHR. But WKY is more susceptible than SHR to BNP-45 for diuresis, natriuresis and urinary cGMP excretion. In addition, high dose of BNP-45 (rat) cuases prolonged lowering of blood pressure and urinary cGMP excretion in WKY[1].

Solvent & Solubility
In Vitro: 

H2O

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1984 mL 0.9919 mL 1.9839 mL
5 mM 0.0397 mL 0.1984 mL 0.3968 mL
10 mM 0.0198 mL 0.0992 mL 0.1984 mL
*Please refer to the solubility information to select the appropriate solvent.
Animal Administration
[1]

Rats[1]
Male anesthetized spontaneously hypertensive rats (SHR) and Wistar-Kyoto rats (WKY) (20- to 25 week-old) are used in the assay. Isotonic saline (20 μL/min) is infused throughout the esperiment. After equilibration for at least 60 min, urine is collected every 10 min during a 20-min control period. Rat BNP-45 or rat α-ANP (0.1, O.2, 0.5, 1.0 and 2.0 nmol/kg) dissolved in saline containing 1% bacitracin is injected i.v., and urine is collected continuously for three to six 10-min periods following each dose. There is a 30- to 60-min rest interval between each injection, to allow the urine volume to return to a steady baseline value. Urine volume is determined by weight. Urinary sodium and potassium are measured by flame photometry. The concentration of cGMP in urine is measured by radioimmunoassay, using cGMP assay kit[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

5040.67

Formula

C₂₁₃H₃₄₉N₇₁O₆₅S₃

CAS No.

123337-89-3

SMILES

[SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfide bridge: Cys23-Cys39)]

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Shipping

Room temperature in continental US; may vary elsewhere

  • Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge: Cys23-Cys39);不竞价
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BNP-45 rat
Cat. No.:
HY-P1573
Quantity:

BNP-45 rat

Cat. No.: HY-P1573