Brain Natriuretic Peptide-45, rat
Brain Natriuretic Peptide-45, rat (BNP-45, rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.
For research use only. We do not sell to patients.
- CAS No.: 123337-89-3
- Formula: C213H349N71O65S3
- Molecular Weight:5040.67
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Protocol
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 123337-89-3
-
Molecular Weight 5040.67
-
Formula C213H349N71O65S3
-
Synonyms
BNP-45, rat
-
Sequence
Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys23-Cys39)
-
Sequence Shortening
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys23-Cys39)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Solvent & Solubility
H2O
Peptide Solubility and Storage Guidelines:
1. Calculate the length of the peptide.
2. Calculate the overall charge of the entire peptide according to the following table:
| Contents | Assign value | |
| Acidic amino acid | Asp (D), Glu (E), and the C-terminal -COOH. | -1 |
| Basic amino acid | Arg (R), Lys (K), His (H), and the N-terminal -NH2 | +1 |
| Neutral amino acid | Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) | 0 |
3. Recommended solution:
| Overall charge of peptide | Details |
| Negative (<0) |
1. Try to dissolve the peptide in water first. 2. If water fails, add NH4OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide. |
| Positive (>0) |
1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO. |
| Zero (=0) |
1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration. |
Protocol
Rats[1]
Male anesthetized spontaneously hypertensive rats (SHR) and Wistar-Kyoto rats (WKY) (20- to 25 week-old) are used in the assay. Isotonic saline (20 μL/min) is infused throughout the esperiment. After equilibration for at least 60 min, urine is collected every 10 min during a 20-min control period. Rat BNP-45 or rat α-ANP (0.1, O.2, 0.5, 1.0 and 2.0 nmol/kg) dissolved in saline containing 1% bacitracin is injected i.v., and urine is collected continuously for three to six 10-min periods following each dose. There is a 30- to 60-min rest interval between each injection, to allow the urine volume to return to a steady baseline value. Urine volume is determined by weight. Urinary sodium and potassium are measured by flame photometry. The concentration of cGMP in urine is measured by radioimmunoassay, using cGMP assay kit[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Brain Natriuretic Peptide-45, rat Related Classifications
HY-P1573 Related Classifications
Powered by Bioz