Dendrotoxin-I TFA
Based on 1 Customer Validation
Dendrotoxin-I (DTX-I) TFA is a potent K+ channel blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6. Dendrotoxin-I TFA, a neurotoxin, has the potential for cancer research.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 99.85%
- Formule: C312H491N99O83S6.xC2HF3O2
- Masse moléculaire:7149.24 (free acid)
-
Stockage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Activité biologique
|
Kv1.1 0.13-50 nM (IC50) |
Kv1.2 0.13-50 nM (IC50) |
Kv1.6 0.13-50 nM (IC50) |
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Nude mice with MCF-7 cells[3]
-
Dosage:5 mg/kg
-
Administration:IV
-
Result:Displayed a significanttumor growth inhibition effect combined with hyperthermia.
Could not keep on inhibiting the growth of tumor at the later period of treatment.
Chemical Information
-
Appearance Solid
-
Masse moléculaire 7149.24 (free acid)
-
Formule C312H491N99O83S6.xC2HF3O2
-
Color White to off-white
-
Synonyms
DTX-I TFA
-
Sequence
Gln-Pro-Leu-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Gln-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Gly-Phe-Thr-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Arg-Lys (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)
-
Sequence Shortening
QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvant et solubilité
H2O : 100 mg/mL (Need ultrasonic)
0.05 M Sodium acetate : 50 mg/mL (adjust pH to 3 with CH3COOH)
Pureté et documentation
-
Fiche technique (288 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Qiwen Liao, et al. Novel Kunitz-like Peptides Discovered in the Zoanthid Palythoa caribaeorum through Transcriptome Sequencing. J Proteome Res. 2018 Feb 2;17(2):891-902. [Content Brief]
[2]. Tess Wright, et al. Firing frequency and entrainment maintained in primary auditory neurons in the presence of combined BDNF and NT3. Sci Rep. 2016 Jun 23;6:28584. [Content Brief]
[3]. Hui Zhang, et al. Preparation, characterization, and pharmacodynamics of thermosensitive liposomes containing docetaxel. J Pharm Sci. 2014 Jul;103(7):2177-2183. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)