country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P6008

Copy Link Print Information

Myoregulin

(Synonyms: MLN peptide)

Myoregulin (MLN peptide) is a member of the regulin family. Myoregulin regulates muscle performance by modulating intracellular calcium handling. Myoregulin interactes directly with sarcoplasmic reticulum Ca²⁺-ATPase (SERCA) and impedinf Ca²⁺ uptake into the sarcoplasmic reticulum.

For research use only. We do not sell to patients.

Formula: C₂₃₉H₃₉₁N₅₃O₆₇S₃
Molecular Weight:5175.17

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Myoregulin Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

All Calcium Channel Isoforms :

Chemical Information

Molecular Weight 5175.17
Formula C₂₃₉H₃₉₁N₅₃O₆₇S₃
Synonyms

MLN peptide
Sequence

Met-Ser-Gly-Lys-Ser-Trp-Val-Leu-Ile-Ser-Thr-Thr-Ser-Pro-Gln-Ser-Leu-Glu-Asp-Glu-Ile-Leu-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Leu-Phe-Val-Asp-Leu-Met-Ser-Ile-Met-Tyr-Val-Val-Ile-Thr-Ser
Sequence Shortening

MSGKSWVLISTTSPQSLEDEILGRLLKILFVLFVDLMSIMYVVITS
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Anderson DM, et al. A micropeptide encoded by a putative long noncoding RNA regulates muscle performance. Cell. 2015 Feb 12;160(4):595-606. [Content Brief]

[2]. Xinqiang Yin, et al. Distribution of micropeptide-coding sORFs in transcripts.Chinese Chemical Letters. Volume 29, Issue 7, July 2018, Pages 1029-1032.

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock