Nagrestipen
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis.
Para uso exclusivo en investigación. No vendemos a pacientes.
- No. CAS: 166089-33-4
- Fòrmula: C338H516N88O108S4
- Peso molecular:7668.48
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Nagrestipen (ECI 301) (i.v; 0.08, 0.4, 2 μg; day 1,8,15) can inhibit tumor growth in a dose-dependent manner at both irradiated and unirradiated sites of female C57BL/6 with LLC cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male BALB/c mice with Colon26 cells and MethA cells[1]
-
Dosage:2 μg
-
Administration:Intravenous injection; daily for 5 days
-
Result:Significantly inhibited tumor size without significant toxicity.
Stopped tumor growth in the colon not only at the irradiated site but also at the unirradiated.
Chemical Information
-
No. CAS 166089-33-4
-
Peso molecular 7668.48
-
Fòrmula C338H516N88O108S4
-
Sequence Shortening
SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50)
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Nagrestipen Related Classifications
HY-P3627 Related Classifications
Powered by Bioz