country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Referencia número: HY-P6013A

Copy Link Print Information

wt hMLN TFA

Revisión del cliente

Based on 1 Customer Validation

wt hMLN (TFA) is a microprotein that inhibits of SR Ca²⁺ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis.

Para uso exclusivo en investigación. No vendemos a pacientes.

Pureza: 95.0%
Fòrmula: C₂₄₅H₄₀₄N₅₄O₆₆S..xC2HF3O2
Peso molecular:5194.22 (free acid)

Almacenamiento:

Sealed storage, away from moisture and light.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

wt hMLN TFA Chemical Structure

Tamaño

Precio

Stock

Cantidad

Amount: USD 0.00

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Actividad biológica

Descripciòn

wt hMLN (TFA) is a microprotein that inhibits of SR Ca²⁺ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis^[1].

Ver todos los productos específicos de isoformas Calcium Channel :

Chemical Information

Appearance Solid
Peso molecular 5194.22 (free acid)
Fòrmula C₂₄₅H₄₀₄N₅₄O₆₆S..xC2HF3O2
Color White to off-white
Sequence

Met-Thr-Gly-Lys-Asn-Trp-Ile-Leu-Ile-Ser-Thr-Thr-Thr-Pro-Lys-Ser-Leu-Glu-Asp-Glu-Ile-Val-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Ile-Phe-Val-Asp-Leu-Ile-Ser-Ile-Ile-Tyr-Val-Val-Ile-Thr-Ser (TFA salt)
Sequence Shortening

MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS (TFA salt)
Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Pureza y Documentación

Select Batch:

Pureza: 99.98%

Assay: 99.98%

ee.: 99.98%

Ficha de datos (264 KB)
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instrucciones de manejo (2659 KB)

Referencias

[1]. Alexis Boulinguiez, et al. NR1D1 controls skeletal muscle calcium homeostasis through myoregulin repression. JCI Insight. 2022 Sep 8; 7(17): e153584.

Calculators

Calculadora de molaridad

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculadora de dilución

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Obtener un presupuesto En stock