BMP-4 Protein, Human (HEK293, E399D)

BMP-4 Protein, Human (HEK293, E399D) is the recombinant human-derived BMP-4 protein, expressed by HEK293, with tag free tag.

The BMP-4 protein is predicted to have BMP receptor binding activity and cytokine activity, playing a crucial role in various processes such as animal organ development, determination of bilateral symmetry, and embryonic morphogenesis. It is expected to be located in the extracellular region and active in the extracellular space. The expression of BMP-4 is observed in several structures, including the cardiovascular system, fin, head, inner ear, and mesoderm. In humans, this gene's orthologs have been implicated in several diseases, such as CAKUT (multiple), cleft lip, orofacial cleft 11, ossification of the posterior longitudinal ligament of the spine, and otosclerosis. The human BMP4 gene serves as the orthologous counterpart to the BMP-4 protein. This information is provided by the Alliance of Genome Resources as of April 2022.

Human

HEK293

Tag Free

P12644 (S293-R408, E399D)

652

Full Length of Mature Protein

SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQDMVVEGCGCR

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/kg-1-cell.html  [Content Brief]