Copy Link Print Information

BMP-4 Protein, Human (E399D)

BMP-4 Protein, Human (E399D) is the recombinant human-derived BMP-4 protein, expressed by E. coli, with tag free tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • BMP-4 Protein, Human (E399D) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

BMP-4 Protein, Human (E399D) is the recombinant human-derived BMP-4 protein, expressed by E. coli, with tag free tag.

Background

The BMP-4 protein is predicted to have BMP receptor binding activity and cytokine activity, playing a crucial role in various processes such as animal organ development, determination of bilateral symmetry, and embryonic morphogenesis. It is expected to be located in the extracellular region and active in the extracellular space. The expression of BMP-4 is observed in several structures, including the cardiovascular system, fin, head, inner ear, and mesoderm. In humans, this gene's orthologs have been implicated in several diseases, such as CAKUT (multiple), cleft lip, orofacial cleft 11, ossification of the posterior longitudinal ligament of the spine, and otosclerosis. The human BMP4 gene serves as the orthologous counterpart to the BMP-4 protein. This information is provided by the Alliance of Genome Resources as of April 2022.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P12644 (S293-R408, E399D)

  • Gene ID
    652
  • Molecular Construction
    • N-term
    • BMP-4 (S293-R408, E399D)
      Accession # P12644
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    rHuBMP-4; BMP-2B

  • AA Sequence

    SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQDMVVEGCGCR

  • Predicted Molecular Mass

    13.3 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • BMP-4 Protein, Human (E399D) Product Image
    1/16
  • BMP-4 Protein, Human (E399D) Product Image