1. Recombinant Proteins
  2. Others
  3. BMP-4 Protein, Human (HEK293, E399D)

BMP-4 Protein, Human (HEK293, E399D) is the recombinant human-derived BMP-4 protein, expressed by E. coli, with tag free tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMP-4 Protein, Human (HEK293, E399D) is the recombinant human-derived BMP-4 protein, expressed by E. coli, with tag free tag.

Background

The BMP-4 protein is predicted to have BMP receptor binding activity and cytokine activity, playing a crucial role in various processes such as animal organ development, determination of bilateral symmetry, and embryonic morphogenesis. It is expected to be located in the extracellular region and active in the extracellular space. The expression of BMP-4 is observed in several structures, including the cardiovascular system, fin, head, inner ear, and mesoderm. In humans, this gene's orthologs have been implicated in several diseases, such as CAKUT (multiple), cleft lip, orofacial cleft 11, ossification of the posterior longitudinal ligament of the spine, and otosclerosis. The human BMP4 gene serves as the orthologous counterpart to the BMP-4 protein. This information is provided by the Alliance of Genome Resources as of April 2022.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P12644 (S293-R408, E399D)

Gene ID

652

Molecular Construction
N-term
BMP-4 (S293-R408, E399D)
Accession # P12644
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuBMP-4; BMP-2B
AA Sequence

SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQDMVVEGCGCR

Predicted Molecular Mass
13.3 kDa
Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BMP-4 Protein, Human (HEK293, E399D) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BMP-4 Protein, Human (HEK293, E399D)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-4 Protein, Human (HEK293, E399D)
Cat. No.:
HY-P703875
Quantity:
MCE Japan Authorized Agent: