MIP-1 alpha/CCL3 Protein, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

CCL3 protein, a monokine with inflammatory and chemokinetic properties, exhibits chemotactic activity for a variety of immune cells, including monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It plays a crucial role in lung TNF-alpha production, neutrophil recruitment, and subsequent lung injury, potentially serving as an autocrine mediator for macrophage-produced TNF-alpha. This, in turn, up-regulates vascular adhesion molecules essential for neutrophil influx. Additionally, CCL3 protein demonstrates binding affinity for heparin.

1.Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human blood monocytes is in a concentration range of 10-100 ng/mL.
2.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED₅₀ for this effect is 3.140 ng/mL, corresponding to a specific activity is 3.185×10⁵ U/mg.

• 
  Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5.The ED₅₀ for this effect is 3.140 ng/mL, corresponding to a specific activity is 3.185×10⁵U/mg.

Rat

E. coli

Tag Free

P50229 (A24-A92)

25542  [NCBI]

Full Length of Mature Protein

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.