MIP-1 alpha/CCL3 Protein, Rat

Revisión del cliente

Based on 1 Customer Validation

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Rat
  • Source: E. coli
  • Almacenamiento:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Actividad biológica
  • Technical Parameters
  • Product Properties
  • Documentación
  • Help & FAQs

Actividad biológica

Descripciòn

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Background

CCL3 protein, a monokine with inflammatory and chemokinetic properties, exhibits chemotactic activity for a variety of immune cells, including monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It plays a crucial role in lung TNF-alpha production, neutrophil recruitment, and subsequent lung injury, potentially serving as an autocrine mediator for macrophage-produced TNF-alpha. This, in turn, up-regulates vascular adhesion molecules essential for neutrophil influx. Additionally, CCL3 protein demonstrates binding affinity for heparin.

Verified Bioactivity

1.Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human blood monocytes is in a concentration range of 10-100 ng/mL.
2.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is 3.140 ng/mL, corresponding to a specific activity is 3.185×105 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5.The ED50 for this effect is 3.140 ng/mL, corresponding to a specific activity is 3.185×105U/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL3 (A24-A92)
      Accession # P50229
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL3; Tonsillar Lymphocyte LD78 Alpha Protein; Prev. SCYA3; C-C Motif Chemokine 3; MIP-1-Alpha; PAT 464.1; G0S19-1; SIS-Beta; LD78ALPHA; MIP1A; LD78; Macrophage Inflammatory Protein 1 Alpha; SCI; Chemokine (C-C Motif) Ligand 3; Small Inducible Cytokine A3

  • AA Sequence

    APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

  • Predicted Molecular Mass

    7.8 kDa

  • Peso molecular

    Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

  • Pureza

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtener un presupuesto En stock

Other size
Obtener un presupuesto
Please select quantity
Amount: USD 0.00