COMT Protein, Human (His)
Based on 1 Customer Validation
Catechol-O-methyltransferase (COMT) plays a crucial role by catalyzing and inactivating the O-methylation of catecholamine neurotransmitters and catechol hormones. This enzyme activity is critical for regulating the biological half-life of key neuroactive compounds, including catecholamines. COMT Protein, Human (His) is the recombinant human-derived COMT protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Catechol-O-methyltransferase (COMT) plays a crucial role by catalyzing and inactivating the O-methylation of catecholamine neurotransmitters and catechol hormones. This enzyme activity is critical for regulating the biological half-life of key neuroactive compounds, including catecholamines. COMT Protein, Human (His) is the recombinant human-derived COMT protein, expressed by E. coli , with N-6*His labeled tag.
Catechol-O-methyltransferase (COMT) is a crucial enzyme that catalyzes the O-methylation and subsequent inactivation of catecholamine neurotransmitters and catechol hormones. By mediating the transfer of a methyl group to these molecules, COMT plays a pivotal role in regulating the levels and activity of neurotransmitters such as dopamine, epinephrine, and norepinephrine. Beyond its involvement in catecholamine metabolism, COMT also shortens the biological half-lives of specific neuroactive drugs, including L-DOPA, alpha-methyl DOPA, and isoproterenol. This enzymatic activity is significant in modulating the pharmacokinetics of therapeutic agents targeting neurological and hormonal pathways. The regulatory role of COMT in both endogenous neurotransmitters and exogenous drugs highlights its importance in the fine-tuning of neurotransmission and drug responses, showcasing its broad impact on physiological and pharmacological processes.
Measured by its ability to methylate catechol to O-methyl-catechol. The specific activity is 317.457 nmol/min/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P21964 (G52-P271)
-
Molecular Construction
-
N-term
-
6*His
-
COMT (G52-P271)
Accession # P21964 -
C-term
-
-
Protein Length
Partial
-
Synonyms
COMT; Catechol-O-Methyltransferase Isoform; Catechol-O-Methyltransferase; Testicular Tissue Protein Li 42; Catechol O-Methyltransferase; HEL-S-98n; Epididymis Secretory Sperm Binding Protein Li 98n
-
AA Sequence
GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
-
Molecular Weight
Approximately 25-28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
