CTCF Protein, Human
Based on 1 publication(s) in Google Scholar
CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free.
Background
CTCF protein is a chromatin-binding factor with diverse roles in transcriptional regulation and epigenetic control. It binds to DNA sequence-specific sites, functioning as a transcriptional repressor by interacting with chromatin insulators, preventing undesired interactions between promoters and nearby enhancers or silencers. Notably, it represses the promoters of genes like MYC and BAG1, while activating transcription of APP. CTCF regulates the APOA1/C3/A4/A5 gene cluster, controls MHC class II gene expression, and plays a crucial role in oocyte and preimplantation embryo development. Functioning as a tumor suppressor, CTCF participates in allele-specific gene expression at the imprinted IGF2/H19 gene locus and is involved in gene silencing over considerable genomic distances. It preferentially interacts with unmethylated DNA, preventing CpG methylation spreading and maintaining methylation-free zones. CTCF is essential for chromatin remodeling, dimerizing when bound to different DNA sequences to mediate long-range chromatin looping. It anchors nucleosomes, influences X-chromosome pairing, and contributes to the regulatable epigenetic switch for X chromosome inactivation. Furthermore, CTCF associates with centromeres and chromosomal arms during metaphase, contributing to sister chromatid cohesion and recruiting CENPE to pericentromeric/centromeric regions during mitosis. Its interaction with CHD8 and LLPH, along with its multifaceted regulatory functions, underscores the critical role of CTCF in the intricate landscape of chromatin organization and gene expression.
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P49711-1 (M1-I154)
-
Molecular Construction
-
N-term
-
CTCF (M1-I154)
Accession # P49711-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CTCF; CFAP108; CCCTC-Binding Factor; FAP108; Transcriptional Repressor CTCF; CCCTC-Binding Factor (Zinc Finger Protein); 11-Zinc Finger Protein; 11 Zinc Finger Transcriptional Repressor; CTCFL Paralog; MRD21
-
AA Sequence
MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI
-
Predicted Molecular Mass
16.9 kDa
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)