CTCF Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free.

Background

CTCF protein is a chromatin-binding factor with diverse roles in transcriptional regulation and epigenetic control. It binds to DNA sequence-specific sites, functioning as a transcriptional repressor by interacting with chromatin insulators, preventing undesired interactions between promoters and nearby enhancers or silencers. Notably, it represses the promoters of genes like MYC and BAG1, while activating transcription of APP. CTCF regulates the APOA1/C3/A4/A5 gene cluster, controls MHC class II gene expression, and plays a crucial role in oocyte and preimplantation embryo development. Functioning as a tumor suppressor, CTCF participates in allele-specific gene expression at the imprinted IGF2/H19 gene locus and is involved in gene silencing over considerable genomic distances. It preferentially interacts with unmethylated DNA, preventing CpG methylation spreading and maintaining methylation-free zones. CTCF is essential for chromatin remodeling, dimerizing when bound to different DNA sequences to mediate long-range chromatin looping. It anchors nucleosomes, influences X-chromosome pairing, and contributes to the regulatable epigenetic switch for X chromosome inactivation. Furthermore, CTCF associates with centromeres and chromosomal arms during metaphase, contributing to sister chromatid cohesion and recruiting CENPE to pericentromeric/centromeric regions during mitosis. Its interaction with CHD8 and LLPH, along with its multifaceted regulatory functions, underscores the critical role of CTCF in the intricate landscape of chromatin organization and gene expression.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CTCF (M1-I154)
      Accession # P49711-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rHuTranscriptional repressor CTCF/CTCF; Transcriptional Repressor CTCF; 11-Zinc Finger Protein; CCCTC-Binding Factor; CTCFL Paralog; CTCF

  • AA Sequence

    MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI

  • Predicted Molecular Mass

    16.9 kDa

  • Molecular Weight

    Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00