1. Recombinant Proteins
  2. Others
  3. CTCF Protein, Human

CTCF Protein, Human

Cat. No.: HY-P70039
COA Handling Instructions

CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free. The total length of CTCF Protein, Human is 154 a.a., with molecular weight of ~38 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $130 In-stock
50 μg $360 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free. The total length of CTCF Protein, Human is 154 a.a., with molecular weight of ~38 kDa.

Background

CTCF protein is a chromatin-binding factor with diverse roles in transcriptional regulation and epigenetic control. It binds to DNA sequence-specific sites, functioning as a transcriptional repressor by interacting with chromatin insulators, preventing undesired interactions between promoters and nearby enhancers or silencers. Notably, it represses the promoters of genes like MYC and BAG1, while activating transcription of APP. CTCF regulates the APOA1/C3/A4/A5 gene cluster, controls MHC class II gene expression, and plays a crucial role in oocyte and preimplantation embryo development. Functioning as a tumor suppressor, CTCF participates in allele-specific gene expression at the imprinted IGF2/H19 gene locus and is involved in gene silencing over considerable genomic distances. It preferentially interacts with unmethylated DNA, preventing CpG methylation spreading and maintaining methylation-free zones. CTCF is essential for chromatin remodeling, dimerizing when bound to different DNA sequences to mediate long-range chromatin looping. It anchors nucleosomes, influences X-chromosome pairing, and contributes to the regulatable epigenetic switch for X chromosome inactivation. Furthermore, CTCF associates with centromeres and chromosomal arms during metaphase, contributing to sister chromatid cohesion and recruiting CENPE to pericentromeric/centromeric regions during mitosis. Its interaction with CHD8 and LLPH, along with its multifaceted regulatory functions, underscores the critical role of CTCF in the intricate landscape of chromatin organization and gene expression.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P49711 (M1-I154)

Gene ID
Molecular Construction
N-term
CTCF (M1-I154)
Accession # P49711
C-term
Synonyms
rHuTranscriptional repressor CTCF/CTCF; Transcriptional Repressor CTCF; 11-Zinc Finger Protein; CCCTC-Binding Factor; CTCFL Paralog; CTCF
AA Sequence

MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI

Molecular Weight

Approximately 38 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CTCF Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTCF Protein, Human
Cat. No.:
HY-P70039
Quantity:
MCE Japan Authorized Agent: