Copy Link Print Information

FSHR Protein, Human (His)

Revisión del cliente

Based on 1 Customer Validation

FSHR, a G protein-coupled receptor, specifically recognizes follitropin (FSH) and activates PI3K-AKT and ERK1/ERK2 pathways by promoting cAMP production. Operating as a homotrimer, FSHR binds the heterodimeric FSH hormone, forming a functional unit for signal transduction. Its regulatory mechanisms involve interaction with ARRB2, and independently of FSH stimulation, it engages with APPL2, demonstrating versatility in diverse cellular contexts. FSHR Protein, Human (His) is the recombinant human-derived FSHR protein, expressed by E. coli , with N-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Human
  • Source: E. coli
  • Almacenamiento:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FSHR Protein, Human (His)
  • Experimental Validation Results for FSHR Protein, Human (His)
  • Experimental Validation Results for FSHR Protein, Human (His)
  • FSHR Protein, Human (His) Product Image
Tamaño
Precio
Stock
Cantidad
Amount: USD 0.00
Please select quantity
or
or

* Seleccione Cantidad antes de agregar artículos.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Encuentre su distribuidor local Your local distributor: Hycultec GmbHHycultec
  • Actividad biológica
  • Technical Parameters
  • Product Properties
  • Documentación
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Actividad biológica

Descripciòn

FSHR, a G protein-coupled receptor, specifically recognizes follitropin (FSH) and activates PI3K-AKT and ERK1/ERK2 pathways by promoting cAMP production. Operating as a homotrimer, FSHR binds the heterodimeric FSH hormone, forming a functional unit for signal transduction. Its regulatory mechanisms involve interaction with ARRB2, and independently of FSH stimulation, it engages with APPL2, demonstrating versatility in diverse cellular contexts. FSHR Protein, Human (His) is the recombinant human-derived FSHR protein, expressed by E. coli , with N-6*His labeled tag.

Background

FSHR is a G protein-coupled receptor specifically designed for the recognition of follitropin, also known as follicle-stimulating hormone. This receptor activates downstream signaling pathways, including the PI3K-AKT and ERK1/ERK2 pathways, by facilitating cAMP production. As a homotrimer, FSHR binds to the heterodimeric FSH hormone, consisting of CGA and FSHB subunits, forming a functional unit for signal transduction. FSHR's interaction with ARRB2 contributes to its regulatory mechanisms, and it also engages with APPL2 independently of follicle-stimulating hormone stimulation, showcasing its versatility in diverse cellular contexts.

Verified Bioactivity

1.Immobilized Human FSH Fc (HY-P74133) at 2 μg/mL (100μL/well) can bind Biotinylated Human FSHR. The ED50 for this effect is 0.265 μg/mL.
2.Immobilized Human FSH (HY-P70237) at 2 μg/mL (100 μL/well) can bind Biotinylated Human FSHR. The ED50 for this effect is 0.5152 μg/mL.
3.Immobilized Human FSHR at 2 μg/mL (100 μL/well) can bind Human FSH Fc (HY-P74133). The ED50 for this effect is 1.099 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human FSH Fc (HY-P74133) at 2 μg/mL (100μL/well) can bind Biotinylated Human FSHR. The ED50 for this effect is 0.265 μg/mL.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human FSHR at 2 μg/mL (100 μL/well) can bind Human FSH Fc (HY-P74133). The ED50 for this effect is 1.099 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P23945-1 (C18-R366)

  • Gene ID
    2492  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • FSHR (C18-R366)
      Accession # P23945-1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    FSHR; FSHRO; Prev. ODG1; FSH Receptor; LGR1; FSHR1; Follicle-Stimulating Hormone Receptor; FSH-R; Follitropin Receptor; Follicle Stimulating Hormone Receptor; LRRNT Domain-Containing Protein

  • AA Sequence

    CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR

  • Peso molecular

    Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

  • Pureza

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4 or
2.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtener un presupuesto En stock

Other size
Obtener un presupuesto
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human FSH Fc (HY-P74133) at 2 μg/mL (100μL/well) can bind Biotinylated Human FSHR. The ED50 for this effect is 0.265 μg/mL.

  • 1/16

    MedChemExpress Validation
     Immobilized Human FSHR at 2 μg/mL (100 μL/well) can bind Human FSH Fc (HY-P74133). The ED50 for this effect is 1.099 μg/mL.

  • FSHR Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for FSHR Protein, Human (His)
  • Experimental Validation Results for FSHR Protein, Human (His)
  • Experimental Validation Results for FSHR Protein, Human (His)
  • FSHR Protein, Human (His) Product Image