MAP3K14 Protein, Human (sf9)
Based on 1 Customer Validation
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Verified Bioactivity
The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q99558 (K330-Q679)
-
Gene ID9020
-
Molecular Construction
-
N-term
-
GST
-
MAP3K14 (K330-Q679)
Accession # Q99558 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MAP3K14; Serine/Threonine-Protein Kinase NIK; Mitogen-Activated Protein Kinase Kinase Kinase 14; NF-Kappa-Beta-Inducing Kinase; NIK; Serine/Threonine Protein-Kinase; FTDCR1B; IMD112; HSNIK; HsNIK; HS
-
AA Sequence
KFSVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGGLKSPWRGEYKEPRHPPPNQ
-
Molecular Weight
Approximately 39 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.9, 200 mM NaCl, 10% glycerol, 10 mM MgCl2, 1 mM TCEP.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)