PPAR gamma Protein, Mouse (His)
Based on 1 Customer Validation
PPAR gamma is a regulator of adipocyte differentiation and glucose homeostasis, belonging to nuclear receptor protein families. PPAR gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. PPAR gamma Protein, Mouse (His) is expressed by E. coli and carries a N-terminal 10*His tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PPAR gamma is a regulator of adipocyte differentiation and glucose homeostasis, belonging to nuclear receptor protein families. PPAR gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. PPAR gamma Protein, Mouse (His) is expressed by E. coli and carries a N-terminal 10*His tag[1].
Background
Peroxisome Proliferator-Activated Receptors (PPARs) are nuclear receptor proteins, essentially acting as a master switch for regulating metabolism. PPARs can sense lipid metabolites and control cell differentiation and energy balance. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. PPAR-gamma is a regulator of adipocyte differentiation and glucose homeostasis used extensively in research involving lipid metabolism, adipocyte differentiation, and insulin sensitivity. Alternatively spliced transcript variants of PPAR gamma that encode different isoforms have been described[1].
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His
-
Accession
P37238 (M1-Y505, N383S)
-
Gene ID19016
-
Protein Length
Full Length
-
Synonyms
PPARG; PPARG5; Peroxisome Proliferator Activated Receptor Gamma; Peroxisome Proliferator-Activated Receptor-Gamma Splicing; NR1C3; Peroxisome Proliferative Activated Receptor, Gamma; Peroxisome Proliferator-Activated Receptor Gamma; Peroxisome Proliferator-Activated Receptor-Gamma 5; Nuclear Receptor Subfamily 1 Group C Member 3; PPAR Gamma; PPAR-Gamma; PPARG2D5; PPARgamma; FPLD3; PPARG2; CIMT1; PPARG1; GLM1
-
AA Sequence
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
-
Predicted Molecular Mass
65.1 kDa
-
Molecular Weight
Approximately 66-68 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)