PPAR gamma Protein, Mouse (His)

PPAR gamma is a regulator of adipocyte differentiation and glucose homeostasis, belonging to nuclear receptor protein families. PPAR gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. PPAR gamma Protein, Mouse (His) is expressed by E. coli and carries a N-terminal 10*His tag^[1].

Peroxisome Proliferator-Activated Receptors (PPARs) are nuclear receptor proteins, essentially acting as a master switch for regulating metabolism. PPARs can sense lipid metabolites and control cell differentiation and energy balance. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. PPAR-gamma is a regulator of adipocyte differentiation and glucose homeostasis used extensively in research involving lipid metabolism, adipocyte differentiation, and insulin sensitivity. Alternatively spliced transcript variants of PPAR gamma that encode different isoforms have been described^[1].

Mouse

E. coli

N-10*His

P37238 (M1-Y505)

19016

Full Length

MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY

Approximately 66 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of Tris-based buffer, 50% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Abdelrahman M, et al. Beneficial effects of PPAR-gamma ligands in ischemia-reperfusion injury, inflammation and shock. Cardiovasc Res. 2005 Mar 1;65(4):772-81.