ZNRF2 Protein, Human
Based on 1 Customer Validation
ZNRF2 protein is an E3 ubiquitin protein ligase that plays a crucial role in neuronal transmission and plasticity. It ubiquitinates Na(+)/K(+) ATPase α-1 subunit/ATP1A1, affecting its endocytosis or degradation, which is critical for neuronal function. ZNRF2 Protein, Human is the recombinant human-derived ZNRF2 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ZNRF2 protein is an E3 ubiquitin protein ligase that plays a crucial role in neuronal transmission and plasticity. It ubiquitinates Na(+)/K(+) ATPase α-1 subunit/ATP1A1, affecting its endocytosis or degradation, which is critical for neuronal function. ZNRF2 Protein, Human is the recombinant human-derived ZNRF2 protein, expressed by E. coli , with tag free.
ZNRF2 Protein, an E3 ubiquitin-protein ligase, assumes a crucial role in the establishment and maintenance of neuronal transmission and plasticity. One of its key functions involves the ubiquitination of the Na(+)/K(+) ATPase alpha-1 subunit/ATP1A1, thereby influencing its endocytosis and/or degradation, a process integral to neuronal function. Additionally, ZNRF2 serves as a positive regulator of mTORC1 activation in response to amino acids, operating upstream of both the V-ATPase and Rag-GTPases. This regulatory cascade, however, exhibits a self-regulating feedback mechanism, as mTOR phosphorylation of ZNRF2 leads to its inhibition and subsequent targeting to the cytosol. This intricate interplay highlights ZNRF2's multifaceted role in modulating neuronal processes, emphasizing its significance in neuronal transmission and plasticity.
The ubiquitin conjugating activity of ZNRF2 was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1 and Bodipy-ubiquitin. Incubation of ZNRF2 and UBE2W for 60 minutes at 37˚C in the presence of Bodipy-ubiquitin, UBE1 and ATP was compared alongside two control reactions with either ZNRF2 or ATP excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and ZNRF2.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8NHG8 (G2-D242)
-
Gene ID/
-
Molecular Construction
-
N-term
-
ZNRF2 (G2-D242)
Accession # Q8NHG8 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ZNRF2; Zinc/RING Finger Protein 2; Zinc And Ring Finger 2; Zinc And Ring Finger 2, E3 Ubiquitin Protein Ligase; RNF202; RING Finger Protein 202; RING-Type E3 Ubiquitin Transferase ZNRF2; Protein Ells2; E3 Ubiquitin-Protein Ligase ZNRF2; Zinc Finger/RING F
-
AA Sequence
GAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPSASGGAAAAAAAPAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
