1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. ZNRF2 Protein, Human

ZNRF2 protein is an E3 ubiquitin protein ligase that plays a crucial role in neuronal transmission and plasticity. It ubiquitinates Na(+)/K(+) ATPase α-1 subunit/ATP1A1, affecting its endocytosis or degradation, which is critical for neuronal function. ZNRF2 Protein, Human is the recombinant human-derived ZNRF2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
25 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ZNRF2 protein is an E3 ubiquitin protein ligase that plays a crucial role in neuronal transmission and plasticity. It ubiquitinates Na(+)/K(+) ATPase α-1 subunit/ATP1A1, affecting its endocytosis or degradation, which is critical for neuronal function. ZNRF2 Protein, Human is the recombinant human-derived ZNRF2 protein, expressed by E. coli , with tag free.

Background

ZNRF2 Protein, an E3 ubiquitin-protein ligase, assumes a crucial role in the establishment and maintenance of neuronal transmission and plasticity. One of its key functions involves the ubiquitination of the Na(+)/K(+) ATPase alpha-1 subunit/ATP1A1, thereby influencing its endocytosis and/or degradation, a process integral to neuronal function. Additionally, ZNRF2 serves as a positive regulator of mTORC1 activation in response to amino acids, operating upstream of both the V-ATPase and Rag-GTPases. This regulatory cascade, however, exhibits a self-regulating feedback mechanism, as mTOR phosphorylation of ZNRF2 leads to its inhibition and subsequent targeting to the cytosol. This intricate interplay highlights ZNRF2's multifaceted role in modulating neuronal processes, emphasizing its significance in neuronal transmission and plasticity.

Biological Activity

The ubiquitin conjugating activity of ZNRF2 was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1 and Bodipy-ubiquitin. Incubation of ZNRF2 and UBE2W for 60 minutes at 37˚C in the presence of Bodipy-ubiquitin, UBE1 and ATP was compared alongside two control reactions with either ZNRF2 or ATP excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and ZNRF2.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q8NHG8 (G2-D242)

Gene ID

/

Molecular Construction
N-term
ZNRF2 (G2-D242)
Accession # Q8NHG8
C-term
Protein Length

Full Length of Mature Protein

Synonyms
ZNRF2; E3 ubiquitin-protein ligase ZNRF2; Protein Ells2; RING finger protein 202; RING-type E3 ubiquitin transferase ZNRF2; Zinc/RING finger protein 2
AA Sequence

GAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPSASGGAAAAAAAPAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ZNRF2 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZNRF2 Protein, Human
Cat. No.:
HY-P702080
Quantity:
MCE Japan Authorized Agent: