1. Membrane Transporter/Ion Channel Neuronal Signaling
  2. Calcium Channel
  3. SNX-482

SNX-482, a peptidyl toxin of the spider Hysterocrates gigas, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect.

For research use only. We do not sell to patients.

SNX-482 Chemical Structure

SNX-482 Chemical Structure

CAS No. : 203460-30-4

Size Price Stock Quantity
50 μg USD 680 In-stock

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

SNX-482, a peptidyl toxin of the spider Hysterocrates gigas, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect[1][2][3].

IC50 & Target

IC50: 30 nM (CaV2.3 channel)[2]

Molecular Weight

4495.00

Formula

C192H274N52O60S7

CAS No.
Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

Gly-Val-Asp-Lys-Ala-Gly-Cys-Arg-Tyr-Met-Phe-Gly-Gly-Cys-Ser-Val-Asn-Asp-Asp-Cys-Cys-Pro-Arg-Leu-Gly-Cys-His-Ser-Leu-Phe-Ser-Tyr-Cys-Ala-Trp-Asp-Leu-Thr-Phe-Ser-Asp (Disulfide bridge:Cys7-Cys21;Cys14-Cys26;Cys20-Cys33)

Sequence Shortening

GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD (Disulfide bridge:Cys7-Cys21;Cys14-Cys26;Cys20-Cys33)

SMILES

[GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD (Disulfide bridge:Cys7-Cys21;Cys14-Cys26;Cys20-Cys33)]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation

Purity: ≥99.0%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SNX-482
Cat. No.:
HY-P1074
Quantity:
MCE Japan Authorized Agent: