(Pro3) GIP, human TFA
Based on 1 Customer Validation
(Pro3) GIP, human TFA is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human TFA has high binding affinity for human GIPR with Ki/ Kd value of 0.90 nM. (Pro3) GIP, human TFA human can be used for the research of obesity-related diabetes.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 99.89%
- Formule: C226H338N60O64S.xC2HF3O2
- Masse moléculaire:4951.53 (free base)
-
Stockage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
-
Solvant et solubilité
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
Chemical Information
-
Appearance Solid
-
Masse moléculaire 4951.53 (free base)
-
Formule C226H338N60O64S.xC2HF3O2
-
Color White to off-white
-
SMILES
O=C([C@@H](N)CC1=CC=C(O)C=C1)N[C@H](C(N2[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(O)=O)CCC(N)=O)=O)[C@@H](C)O)=O)[C@H](CC)C)=O)CC(N)=O)=O)CC3=CNC=N3)=O)CCCCN)=O)CC4=CNC5=CC=CC=C45)=O)CC(O)=O)=O)CC(N)=O)=O)CCCCN)=O)CCCCN)=O)=O)CCCCN)=O)CCC(N)=O)=O)C)=O)CC(C)C)=O)CC(C)C)=O)CC6=CNC7=CC=CC=C67)=O)CC(N)=O)=O)C(C)C)=O)CC8=CC=CC=C8)=O)CC(O)=O)=O)CCC(N)=O)=O)CCC(N)=O)=O)CC9=CNC=N9)=O)[C@H](CC)C)=O)CCCCN)=O)CC(O)=O)=O)CCSC)=O)C)=O)[C@H](CC)C)=O)CO)=O)CC%10=CC=C(O)C=C%10)=O)CC(O)=O)=O)CO)=O)[C@H](CC)C)=O)CC%11=CC=CC=C%11)=O)[C@@H](C)O)=O)=O)CCC2)=O)C.OC(C(F)(F)F)=O.[x]
-
Synonyms
(Pro3) Gastric Inhibitory Peptide, human TFA
-
Sequence
Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
-
Sequence Shortening
YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Solvant et solubilité
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Pureté et documentation
-
Fiche technique (266 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Victor A Gault, et al. Chemical ablation of gastric inhibitory polypeptide receptor action by daily (Pro3)GIP administration improves glucose tolerance and ameliorates insulin resistance and abnormalities of islet structure in obesity-related diabetes. Diabetes. 2005, 54, 8. [Content Brief]
[2]. A H Sparre-Ulrich, et al. Species-specific action of (Pro3)GIP - a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors. Br J Pharmacol. 2016, 173, 1. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
(Pro3) GIP, human TFA Related Classifications
HY-P3584A Related Classifications
Powered by Bioz