Pancreatic polypeptide TFA
Based on 1 Customer Validation
Pancreatic polypeptide TFA is a neuropeptide Y (NPY) Y4/Y5 receptor agonist.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 99.47%
- Formel: C185H286N52O55S2.xC2HF3O2
- Molecular Weight:4182.70 (free base)
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
-
Lösungsmittel & Löslichkeit
- Reinheit & Dokumentation
-
Help & FAQs
Alle Neuropeptide Y Receptor Isoform-spezifische Produkte anzeigen
More
Biologische Aktivität
Chemical Information
-
Appearance Solid
-
Molecular Weight 4182.70 (free base)
-
Formel C185H286N52O55S2.xC2HF3O2
-
Color White to off-white
-
Sequence
Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
-
Sequence Shortening
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Reinheit & Dokumentation
-
Data Sheet (253 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Pancreatic polypeptide TFA Related Classifications
HY-P4060A Related Classifications
Powered by Bioz