GLP-1(7-36), amide acetate
Based on 10 publication(s) in Google Scholar
GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza: 99.01%
- No. CAS: 1119517-19-9
- Fòrmula: C149H226N40O45.xC2H4O2
- Peso molecular:3297.64 (free base)
-
Almacenamiento:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) GLP-1(7-36), amide acetate
More- J Pharm Anal. 2024 Aug;14(8):100968. [Abstract]
- MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]
- Int J Pept Res Ther. 2026 Mar 10;32(2):38.
- Int J Endocrinol. 2020 Jun 19:2020:1484321. [Abstract]
- bioRxiv. 2025 Nov 3.
- Research Square Preprint. 2024 Jan 9.
- Patent. US20230278991A1.
- Research Square Preprint. 2023 May 22.
- Patent. US20200283424A1.
- Patent. US20200283424A1.
-
Bio/Physico-chemical Assay
-
Bio/Physico-chemical Assay
-
Flow Cytometry
-
Cell Proliferation/Viability Assay
-
Flow Cytometry
Actividad biológica
Cells treated with phorbol 12-myristate 13-acetate for 2 h has significantly higher active GLP-1(7-36), amide acetate concentrations in the media than those in the control. The glucose treatment also increases active GLP-1 secretion from cells in dose-dependent manner. Palmitic, oleic, linoleic or linolenic acid dose-dependently stimulated active GLP-1 secretion from cells. Active GLP-1 secretion is significantly greater with unsaturated fatty acids such as oleic, linoleic and linolenic acids than with palmitic acid. The treatment of NCI-H716 cells with CPE dose-dependently increases active GLP-1 concentrations in the media. A 37% increase is observed in active GLP-1 secretion from these cells at a concentration of 0.1 % CPE[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
No. CAS 1119517-19-9
-
Appearance Solid
-
Peso molecular 3297.64 (free base)
-
Fòrmula C149H226N40O45.xC2H4O2
-
Color White to off-white
-
Synonyms
Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate
-
Sequence
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
-
Sequence Shortening
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (10)
-
Journal Impact Factor
-
Most Recent
-
J Pharm Anal
Baicalein: A potential GLP-1R agonist improves cognitive disorder of diabetes through mitophagy enhancement. [Abstract]2024 Aug;14(8):100968. PMID: 39258173
GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: J Pharm Anal. 2024 Aug;14(8):100968. [Abstract]
GLP-1(7-36), amide acetate, as GLP-1 analogues, facilitated Ca2+ mobilization in a dose-dependent manner in GLP-1R-HEK293 cells.
-
MAbs
Functional GLP-1R antibodies identified from a synthetic GPCR-focused library demonstrate potent blood glucose control. [Abstract]2021 Jan-Dec;13(1):1893425. PMID: 33706686
GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]
TB-59-2 is a potent agonist in the cAMP assay with a similar EC50 as the GLP-1(7-36), amide acetate (30 min) peptide.
GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]
TB01-3 competed with GLP-1(7-36), amide acetate peptide for binding and inhibited the activities of TB01-3 binding in the absence and presence of GLP-1(7-36), amide acetate.
-
-
Int J Endocrinol
GLP-1/GLP-1R Signaling Regulates Ovarian PCOS-Associated Granulosa Cells Proliferation and Antiapoptosis by Modification of Forkhead Box Protein O1 Phosphorylation Sites. [Abstract]2020 Jun 19:2020:1484321. PMID: 32655632
GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19:2020:1484321. [Abstract]
GCs were isolated from the ovaries of PCOS model mice (day 54 of life) and treated with increasing doses of GLP-1(7-36), amide acetate (10, 100, and 1000 nM; 24-120 h). Cell viability was measured by CCK-8 assay. The results showed that 100 nM GLP-1(7-36), amide acetate significantly enhanced the viability of MGCs compared with the blank control group.
GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19:2020:1484321. [Abstract]
Flow cytometry Annexin V-FITC/PI double staining was used to detect the apoptotic rate of PCOS MGCs in control group and GLP-1(7-36), amide acetate (10 nM, 100 nM, and 1000 nM) treated for 48 hours. The results showed that different concentrations of GLP-1(7-36), amide acetate inhibited the apoptosis of PCOS-associated MGCs treated by DHEA. After being treated for 48 hours, the percentage of apoptotic and late-apoptotic cells was 11.97%, 0.343%, 0.152%, and 1.162%, corresponding to the concentration of GLP-1(7-36), amide acetate of 0, 10, 100, and 1000 nM.
GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19:2020:1484321. [Abstract]
Bcl-2, bax, and beta-actin were detected using their specific antibodies by the Western blot analysis for the PCOS MGCs with or without 100 nM GLP-1(7-36), amide acetate interference for 48 hours. The results showed that the expression of bcl-2 protein increased significantly after GLP-1(7-36), amide acetate intervention, while the expression of Bax decreased.
-
-
-
-
-
-
Solvente y solubilidad
H2O : 100 mg/mL (Need ultrasonic)
For the following dissolution methods, please prepare the working solution directly:
It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: PBS
Solubility: 25 mg/mL; Clear solution; Need ultrasonic
Pureza y Documentación
-
Ficha de datos (282 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)